Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
Becaplermin; c sis; FLJ12858; Oncogene SIS; PDGF 2; PDGF B chain; PDGF Beta; PDGF subunit B; PDGF-2; PDGF2; Pdgfb; PDGFB_HUMAN; Platelet derived growth factor 2; Platelet derived growth factor B chain; Platelet derived growth factor beta; Platelet derived growth factor beta polypeptide (oncogene SIS); Platelet derived growth factor beta polypeptide (simian sarcoma viral (v sis) oncogene homolog); Platelet derived growth factor beta polypeptide; Platelet-derived growth factor B chain; Platelet-derived growth factor beta polypeptide; Platelet-derived growth factor subunit B; Proto-oncogene c-Sis; Simian sarcoma viral (v sis) oncogene homolog; SIS; SSV; v sis platelet derived growth factor beta polypeptide
Species
Homo sapiens (Human)
Expression Region
82-190aa
Target Protein Sequence
SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 1-3
working days after receiving your orders. Delivery time may differ from different purchasing way or
location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with
normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance
and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
This Recombinant Human PDGFB is a powerful research tool for investigating the role of Platelet-derived growth factor subunit B (PDGF subunit B) in metabolism. PDGFB plays a vital role in various biological processes, including cell growth, proliferation, and angiogenesis, making it an essential protein to study for a deeper understanding of metabolic pathways.
This Recombinant Human PDGFB features the full length of the mature protein (82-190aa), ensuring accurate representation for your research endeavors. Expressed in E. coli, the protein carries a C-terminal 6xHis tag, facilitating easy purification and detection. With a purity of greater than 90% as determined by SDS-PAGE, and available in both liquid and lyophilized powder forms, this high-quality recombinant protein offers the performance and reliability required for your metabolism-focused research projects.