Recombinant Human Platelet-derived growth factor subunit B(PDGFB)

Code CSB-EP017709HU
Product Type Recombinant Protein
Size US$2062
Uniprot No. P01127
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT
Research Area Cancer
Source E.coli
Gene Names PDGFB
Protein Names Recommended name: Platelet-derived growth factor subunit B Short name= PDGF subunit B Alternative name(s): PDGF-2 Platelet-derived growth factor B chain Platelet-derived growth factor beta polypeptide Proto-oncogene c-Sis IN
Expression Region 82-190aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 28.3 kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Growth factor that plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. Potent mitogen for cells of mesenchymal origin
Involvement in disease Basal ganglia calcification, idiopathic, 5 (IBGC5)
Subcellular Location Secreted
Protein Families PDGF/VEGF growth factor family
Tissue Specificity Expressed at high levels in the heart, brain (sustantia nigra), placenta and fetal kidney. Expressed at moderate levels in the brain (hippocampus), skeletal muscle, kidney and lung.
Database Links

HGNC: 8800

OMIM: 190040

KEGG: hsa:5155

STRING: 9606.ENSP00000330382

UniGene: Hs.1976

Pathway Jak-STAT signaling pathway
MAPK signaling pathway
PI3K-Akt signaling pathway
Focal adhesion
Gap junction
Regulation of actin cytoskeleton
Ras signaling pathway
Phospholipase D signaling pathway
Rap1 signaling pathway

Related Products

PDGFB Antibodies

PDGFB Antibodies for Homo sapiens (Human)

PDGFB Proteins

PDGFB Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.