Recombinant Human Platelet-derived growth factor subunit B (PDGFB)

Code CSB-EP017709HUa0
Abbreviation Recombinant Human PDGFB protein
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Cancer
Alternative Names
PDGF-2;Platelet-derived growth factor B chain;Platelet-derived growth factor beta polypeptide;Proto-oncogene c-Sis
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
82-190aa
Target Protein Sequence
SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
19.2 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Growth factor that plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. Potent mitogen for cells of mesenchymal origin. Required for normal proliferation and recruitment of pericytes and vascular smooth muscle cells in the central nervous system, skin, lung, heart and placenta. Required for normal blood vessel development, and for normal development of kidney glomeruli. Plays an important role in wound healing. Signaling is modulated by the formation of heterodimers with PDGFA.
Gene References into Functions
  1. we identified two potential susceptibility loci for PC risk, which are located in PDGFB at 22q13.1 PMID: 29168174
  2. Treating HepG2 cells with hepatotoxicants resulted in a significant increase in mRNA expression of platelet-derived growth factor BB (PDGF-BB) and transforming growth factor beta (TGFbeta). PMID: 29558627
  3. The morphology and immunophenotype of all 6 cases was analogous to those with the canonical COL1A1-PDGFB fusion; none of the cases showed fibrosarcomatous transformation. This study illustrates that the COL6A3-PDGFD fusion product is rare in dermatofibrosarcoma protuberans, and associated with an apparent predilection for breast PMID: 30014607
  4. PDGF-B expression was found in ovarian tumor microvessels in 72% of cases. High expression of PDGF in pericapillary cells was strongly associated with high expression of this marker in cancer cells. Significant correlations between PDGF-B and nestin expression in malignant tumor microvessels were also found. PMID: 28397199
  5. SOX7 transcription factor mediates PDGF-BB-induced IL-33 expression. PMID: 27150562
  6. High expression of PDGF-BB may be involved in the pathogenesis of Graves' disease. CCR2-positive macrophages may induce the expression of PDGF-BB through HIF-1alpha signal. PMID: 29319128
  7. rhPDGF-BB promoted the proliferation of hADSCs via miR-363/PI3K/Akt pathway, indicating that rhPDGF-BB combined with ADSCs could treat Achilles tendinitis via miR-363/PI3K/Akt pathway. PMID: 28766166
  8. This study identifies the mbPDGF-BB in cell derived extracellular vesicles as a relevant mediator of diabetes-associated vascular smooth muscle cell resistance to apoptosis. PMID: 29386225
  9. This review showed that PDGFB was one of the common gene involved included with brain calcification. PMID: 28162874
  10. Rare Skin Tumor Dermatofibrosarcoma Protuberans (DFSP) is characterized by the translocation of the PDGFB gene to the collagen 1A1 gene. PMID: 28940884
  11. Transglutaminase type 2 affects cell migration through post-translational modification of PDGF-BB. PMID: 27633721
  12. PDGF-B rs1800818 polymorphism might play a role in mediating the susceptibility to severe fever with thrombocytopenia syndrome in Chinese individuals. PMID: 27147565
  13. PDAP-1 as an effecter of PDGF signaling in glioma cells PMID: 27448842
  14. High PDGFB expression is associated with gastric cancer. PMID: 28423550
  15. We observed that regenerating and necrotic muscle fibers in muscle biopsy samples from Duchenne muscular dystrophy patients expressed PDGF-BB. PMID: 28618254
  16. Elevated PDGFB expression was noted in 29% of patients with papillary renal cell carcinoma. PMID: 27989785
  17. high-throughput affinity plasma proteomic profiling is a valuable research strategy to identify potential candidate biomarkers for thrombosis-related disorders, and our study suggests a novel association of PDGFB plasma levels with venous thromboembolism. PMID: 27742707
  18. High PDGFB expression is associated with glioma. PMID: 26951930
  19. A cell-autonomous positive-signaling circuit is associated with the PDGF-NO-ID4-regulatory axis in glioblastoma cells. PMID: 28327358
  20. SphK1 is regulated by PDGF-BB in pulmonary artery smooth muscle cells via the transcription factor Egr-1, promoting cell proliferation. PMID: 27099350
  21. PDGF-BB regulates the proliferation and differentiation of human melanocytes in a differentiation-stage-specific manner. PMID: 27289338
  22. this study shows that the expression of PDGFB is significantly downregulated in keloid fibroblasts compared to normal human fibroblasts PMID: 27465069
  23. this study demonstrated that knockdown of SCARA5 inhibits PDGFBBinduced HASMC proliferation and migration through suppression of the PDGF signaling pathway. PMID: 27035566
  24. The simultaneous action of PDGF-B/PDGFRbeta and VEGF165b on the same type of receptor may explain the resistance to antiangiogenic therapy, which depends on the degree of modulation of PDGFRbeta phosphorylation. PMID: 27127135
  25. The expression of angiogenesis markers VEGF-A, VEGFR, PDGFbetabeta, PDGFR, CCND1 and CA9 was assessed by immunohistochemistry and correlated with overall survival and progression-free survival in patients with renal cell carcinoma undergoing therapy with Sunitinib, but no correlation was found between expression of angiogenesis markers and clinical outcome. PMID: 28011500
  26. ore than 65% of cases had PDGF-BB mRNA amplification, confirming immunohistochemical results. We herein validated PDGF-BB as a potential therapeutic and prognostic tool of ovarian cancer aggressiveness. PMID: 27807074
  27. Case Report: congenital atrophic dermatofibrosarcoma protuberans with COL1A1-PDGFB rearrangement. PMID: 26932148
  28. Placental endothelial cell-derived PDGF-BB recruits human placental multipotent mesenchymal stromal cells involved in vascular development via PDGFR-beta/STAT3 activation PMID: 26353894
  29. Suggest that PDGF-B signaling may play a role in endothelial and cardiomyocyte recovery from ischemia reperfusion injury after heart transplantation. PMID: 26371596
  30. Lessons from SLC20A2, PDGFB, and PDGFRB mutation carriers. Three causative genes have been identified: SLC20A2, PDGFRB and, recently, PDGFB, whose associated phenotype has not yet been extensively studied. PMID: 26129893
  31. loss-of-function mutations in PDGFB or PDGFRB cause Primary Familial Brain Calcification. PMID: 26599395
  32. Three factor model revealed significant gene-gene interaction for PDGFB +286A>G, PDGFB +1135A>C and HER2 Ile165Val SNPs with GBC. Protein-protein interaction showed significant association of PDGFB and HER2 with EGFR receptor signaling pathway. PMID: 26320430
  33. Regulation of Hyaluronan (HA) Metabolism Mediated by HYBID (Hyaluronan-binding Protein Involved in HA Depolymerization, KIAA1199) and HA Synthases in Growth Factor-stimulated Fibroblasts. PMID: 26518873
  34. Electron microscopy structure of PDGFRB [a full-length human platelet-derived growth factor receptor], in complex with its ligand PDGF-B. PMID: 26463591
  35. TM expression in corneal epithelium was modulated during the corneal wound healing process, and may be regulated by PDGF-BB. In addition, rTMD23 has therapeutic potential in corneal injury PMID: 25816372
  36. Our results demonstrated that PDGF-B tumor growth and progression in clear cell renal cell carcinoma PMID: 25766258
  37. PDGFB and IL18R1 represent plausible candidates for studying the pathophysiology of these disorders in the context of TLR4 activation PMID: 25327457
  38. TAZ promotes neuroblastoma cell proliferation and tumorigenicity through up-regulating the expression of PDGF-beta genes. PMID: 25940705
  39. Phloretin inhibits PDGF-BB-induced thoracic aorta smooth muscle cell proliferation and migration. PMID: 25945863
  40. COL1A1-PDGFbeta translocation is specific to dermatofibrosarcoma protuberans. Platelet-derived growth factor may have acted in an autocrine manner to cause cell division, which may have led to the development of dermatofibrosarcoma protuberans PMID: 25924890
  41. the present study, demonstrated for the first time, to the best of our knowledge, that ligustrazine downregulated PDGF-BB-induced VSMC proliferation and migration partly, at least, through inhibiting the activation of the ERK and P38 MAPK signaling. PMID: 25738255
  42. cytoplasmic expression of VEGF, VEGFR2, PDGF-B, and PDGFR-beta in RCC tumour cells is different in various pathologic stage and cell type. Notably, VEGF and PDGF-B expression are higher in papillary than in clear cell renal cell carcinoma. PMID: 25550804
  43. COL1A1-PDGFB is a useful and accurate tool in diagnosing DFSP[ Dermatofibrosarcoma protuberans ] in Koreans. PMID: 25683993
  44. Significant diurnal variations in platelet counts and TGF-b1 and PDGF-BB levels were not observed in platelet-rich plasma. PMID: 24878758
  45. Report lowered PDGF-BB levels in acute pancreatitis and increased PDGF-BB levels in chronic pancreatitis. PMID: 25278706
  46. rhPDGF-BB delivery on a collagen scaffold enhanced cellular proliferation and angiogenesis during the early phase of healing after rotator cuff repair. PMID: 25349036
  47. The mutation of PDGFB cause primary familial brain calcifications. PMID: 25212438
  48. Gain of PDGFB is associated with response to therapy in metastatic renal cell carcinoma. PMID: 24524969
  49. These results suggest that PDGF-BB promotes pulmonary artery smooth muscle cells proliferation and survival, which is likely to be mediated via the JNK pathway. PMID: 24804810
  50. PDGFB hypomethylation is a favourable prognostic biomarker in primary myelofibrosis. PMID: 25498506

Show More

Hide All

Involvement in disease
Basal ganglia calcification, idiopathic, 5 (IBGC5)
Subcellular Location
Secreted. Note=Released by platelets upon wounding.
Protein Families
PDGF/VEGF growth factor family
Tissue Specificity
Expressed at high levels in the heart, brain (sustantia nigra), placenta and fetal kidney. Expressed at moderate levels in the brain (hippocampus), skeletal muscle, kidney and lung.
Database Links

HGNC: 8800

OMIM: 190040

KEGG: hsa:5155

STRING: 9606.ENSP00000330382

UniGene: Hs.1976

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*