Recombinant Human Protein kinase C zeta type (PRKCZ)

Code CSB-YP018710HU
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP018710HU
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP018710HU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP018710HU
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP018710HU
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥85% (SDS-PAGE)
Target Names
Uniprot No.
Alternative Names
Protein kinase C zeta type; EC 2.7.11.13; nPKC-zeta; PRKCZ PKC2
Species
Homo sapiens (Human)
Expression Region
1-592
Target Protein Sequence
MPSRTGPKMEGSGGRVRLKAHYGGDIFITSVDAATTFEELCEEVRDMCRLHQQHPLTLKWVDSEGDPCTVSSQMELEEAFRLARQCRDEGLIIHVFPSTPEQPGLPCPGEDKSIYRRGARRWRKLYRANGHLFQAKRFNRRAYCGQCSERIWGLARQGYRCINCKLLVHKRCHGLVPLTCRKHMDSVMPSQEPPVDDKNEDADLPSEETDGIAYISSSRKHDSIKDDSEDLKPVIDGMDGIKISQGLGLQDFDLIRVIGRGSYAKVLLVRLKKNDQIYAMKVVKKELVHDDEDIDWVQTEKHVFEQASSNPFLVGLHSCFQTTSRLFLVIEYVNGGDLMFHMQRQRKLPEEHARFYAAEICIALNFLHERGIIYRDLKLDNVLLDADGHIKLTDYGMCKEGLGPGDTTSTFCGTPNYIAPEILRGEEYGFSVDWWALGVLMFEMMAGRSPFDIITDNPDMNTEDYLFQVILEKPIRIPRFLSVKASHVLKGFLNKDPKERLGCRPQTGFSDIKSHAFFRSIDWDLLEKKQALPPFQPQITDDYGLDNFDTQFTSEPVQLTPDDEDAIKRIDQSEFEGFEYINPLLLSTEESV
Protein Length
Full Length
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Calcium- and diacylglycerol-independent serine/threonine-protein kinase that functions in phosphatidylinositol 3-kinase (PI3K) pathway and mitogen-activated protein (MAP) kinase cascade, and is involved in NF-kappa-B activation, mitogenic signaling, cell proliferation, cell polarity, inflammatory response and maintenance of long-term potentiation (LTP). Upon lipopolysaccharide (LPS) treatment in macrophages, or following mitogenic stimuli, functions downstream of PI3K to activate MAP2K1/MEK1-MAPK1/ERK2 signaling cascade independently of RAF1 activation. Required for insulin-dependent activation of AKT3, but may function as an adapter rather than a direct activator. Upon insulin treatment may act as a downstream effector of PI3K and contribute to the activation of translocation of the glucose transporter SLC2A4/GLUT4 and subsequent glucose transport in adipocytes. In EGF-induced cells, binds and activates MAP2K5/MEK5-MAPK7/ERK5 independently of its kinase activity and can activate JUN promoter through MEF2C. Through binding with SQSTM1/p62, functions in interleukin-1 signaling and activation of NF-kappa-B with the specific adapters RIPK1 and TRAF6. Participates in TNF-dependent transactivation of NF-kappa-B by phosphorylating and activating IKBKB kinase, which in turn leads to the degradation of NF-kappa-B inhibitors. In migrating astrocytes, forms a cytoplasmic complex with PARD6A and is recruited by CDC42 to function in the establishment of cell polarity along with the microtubule motor and dynein. In association with FEZ1, stimulates neuronal differentiation in PC12 cells. In the inflammatory response, is required for the T-helper 2 (Th2) differentiation process, including interleukin production, efficient activation of JAK1 and the subsequent phosphorylation and nuclear translocation of STAT6. May be involved in development of allergic airway inflammation (asthma), a process dependent on Th2 immune response. In the NF-kappa-B-mediated inflammatory response, can relieve SETD6-dependent repression of NF-kappa-B target genes by phosphorylating the RELA subunit at 'Ser-311'. Phosphorylates VAMP2 in vitro.; Involved in late synaptic long term potention phase in CA1 hippocampal cells and long term memory maintenance.
Gene References into Functions
  1. PKCzeta promoted lung adenocarcinoma invasion and metastasis, and its expression was associated with MMP2 and MMP9 expression. PMID: 28983601
  2. PKC-zeta may be responsible for the abnormal growth, proliferation, and migration of metastatic LOVO colon cancer cells via PKC-zeta/Rac1/Pak1/beta-Catenin pathway. PMID: 29408512
  3. reduced expression of PKCzeta/Pard3/Pard6 contributes to non-small-cell lung cancer epithelial-mesenchymal transition, invasion, and chemoresistance. PMID: 28652146
  4. Intestinal I/R induced the membrane translocation and phosphorylation of PKCzeta. Pretreatment with the PKCzeta activator phosphatidylcholine remarkably attenuated gut injury by suppressing apoptosis. H/R induced PKCzeta to combine with TRAF2, which was phosphorylated by PKCzeta at Ser(55), but not at Ser(11), under intestinal I/R or H/R conditions PMID: 28726782
  5. these results conclude that miR-25 targets PKCzeta and protects osteoblastic cells from Dex via activating AMPK signaling. PMID: 27911275
  6. PKCzeta was specifically involved in ACOT7 depletion-mediated cell cycle arrest as an upstream molecule of the p53-p21 signaling pathway in MCF7 human breast carcinoma and A549 human lung carcinoma cells. PMID: 28518146
  7. we found that Wnt3a treatment rapidly induces hyperphosphorylation and stabilization of Dvl2 and Dvl3. Our findings suggest a model of positive regulation of PKCzeta-mediated Dvl signaling activity, to produce a strong and sustained response to Wnt3a treatment by stabilizing Dvl protein levels. PMID: 28366812
  8. The data demonstrate that PKCzeta expression regulates the maturation of neonatal T-cells into specific functional phenotypes and that environmental influences may work via PKCzeta to regulate these phenotypes and disease susceptibility. PMID: 28159873
  9. Drug discovery efforts have been hindered due to the non-availability of the protein structure and hence in the present study we attempted to build the open and closed models of the protein PKMzeta using homology modeling. PMID: 27490967
  10. This study demonstrated that zinc upregulates PKCzeta by activating GPR39 to enhance the abundance of ZO-1, thereby improving epithelial integrity in S. typhimurium-infected Caco-2 cells. PMID: 28515165
  11. Inhibition of protein kinase C zeta expression in prostate cancer cells promoted chemotaxis of peripheral macrophages and acquisition of M2 phenotypic features. These results were further supported by the finding that silencing of endogenous protein kinase C zeta promoted the expression of prostate cancer cell-derived interleukin-4 and interleukin-10 PMID: 28631559
  12. Here we provide the first evidence that PKC-zeta is a potential target for the treatment of COPD by selective small molecules PMID: 27516147
  13. Study provides evidence for a novel PKC-zeta to p47phox interaction that is required for cell transformation from blebbishields and ROS production in cancer cells. PMID: 27040869
  14. FRET-based translocation assays reveal that insulin promotes the association of both p62 and aPKC with the insulin-regulated scaffold IRS-1. PMID: 27143478
  15. data suggest that the interaction between this novel region in Galphaq and the effector PKCzeta is a key event in Galphaq signaling. PMID: 26887939
  16. The PKC-zeta - induced phosphorylation of GSK-3 beta stimulates GSK-3 beta activity. PMID: 26711256
  17. Over-expression of PRKCZ results in gene and/or protein expression alterations of insulin-like growth factor 1 receptor (IGF1R) and integrin beta 3 (ITGB3) in SKOV3 and OVCAR3 cells. PMID: 25874946
  18. PKCzeta inhibition prevented alternative cleavage and release of TROP2, suggesting that these events require endocytic uptake and exosomal release of the corresponding microvesicles. PMID: 25817572
  19. Data show that aPKC scaffold protein p62 tethers Atypical protein kinase C (aPKC) in an active conformation. PMID: 26187466
  20. PRKCZ methylation is associated with sunlight exposure PMID: 25075435
  21. Neuronal NF1/RAS regulation of cyclic AMP requires atypical PKC zeta activation, which is perturbed in neurofibromatosis type 1. PMID: 25070947
  22. The results indicate that induction and activation of PKCzeta promote TNBC growth, invasion and metastasis. PMID: 24786829
  23. PKCzeta and PKMzeta are overexpressed in TCF3-rearranged paediatric acute lymphoblastic leukaemia and may have a role in thiopurine sensitivity PMID: 24990612
  24. Results indicate that PKCzeta regulates survivin expression levels and inhibits apoptosis in colon cancer cells. PMID: 24920238
  25. These data indicate for the first time that HIV-1 Gag phosphorylation on Ser487 is mediated by atypical PKC and that this kinase may regulate the incorporation of Vpr into HIV-1 virions and thereby supports virus infectivity. PMID: 24447338
  26. STAT3 is an important downstream mediator of the pro-carcinogenic effects of PRKCZ in pancreatic cancer cells. PMID: 24015205
  27. Data indicate that both tumor focality and Par3/Par6/atypical protein kinase C (APKC) expression were significantly associated with tumor recurrence. PMID: 21549621
  28. Results indicate the importance of p62-associated PKCzeta in the overactive state of pagetic osteoclasts (OCs) and in the activation of NF-kappaB, particularly in the presence of the p62(P392L) mutation. PMID: 23266528
  29. The findings suggest a potential role for the use of PKCzeta levels in cord blood T cells as a presymptomatic test to predict allergy risk in children. PMID: 23004934
  30. Study reports that PKCzeta-deficient cells reprogram their metabolism for the utilization of glutamine instead of glucose through the serine biosynthetic cascade controlled by 3-phosphoglycerate dehydrogenase (PHGDH). PMID: 23374352
  31. It was concluded that protein kinase C zeta regulated protein kinase phosphorylation, which in turn regulated the proteolytic activity of phorbol dibutyrate-induced podosomes by influencing the recruitment of protein kinase C zeta and MMP9 to podosomes. PMID: 22740332
  32. A proapoptotic role for protein kinase C zeta in the binding and phosphorylating Bcl10 at the nuclear envelope. PMID: 22812606
  33. A novel sequence was identified within the 3'-terminal domain of human PRKCZ. PMID: 22644296
  34. these findings suggest that PKC-zeta is involved in the phosphorylation of HMGB1, and the phosphorylation of specific serine residues in the nuclear localization signal regions is related to enhanced HMGB1 secretion in colon cancer cells. PMID: 22750245
  35. Stat3 forms a multiprotein complex with Rac1 and PKC in an hypoxia-reoxygenation-dependent manner. PMID: 22791907
  36. Protein kinase C (PKC) zeta expression was significantly higher in normal than in cancerous tissues. Similarly, PKC zeta expression was down-regulated in four renal cancer cell lines compared to immortalized benign renal tubular cells. PMID: 22475628
  37. two key (hub) PPARgamma direct target genes, PRKCZ and PGK1, were experimentally validated to be repressed upon PPARgamma activation by its natural ligand, 15d-PGJ2 in three prostrate cancer cell lines PMID: 21780947
  38. The LNO(2) mediated signaling in lung type II epithelial cells occurs via a unique pathway involving PKCzeta. PMID: 21871968
  39. Western Blot data showed decreased expression (p < 0,05) of Munc18c and phospho-PKC Zeta in polycystic ovary-insulin resistant endometria (PCOSE-IR) with respect to the control. PMID: 22390153
  40. Single nucleotide polymorphisms in protein kinase C zeta are associated with bipolar affective disorder. PMID: 22231931
  41. Report role of PKC-zeta induction in bronchial inflammation and airyway hyperresponsiveness. PMID: 22324796
  42. HGF induced functional CXCR4 receptor expression in breast cancer cells. The effect of HGF was specifically mediated by PKCzeta activity. PMID: 22242160
  43. High levels of protein kinase C zeta expression were associated with lymphatic metastasis in squamous cervical cancer. PMID: 21895402
  44. Inhibition of protein kinase M zeta results in a reduction of synaptic PSD-95 accumulation in developing visual cortex PMID: 21849550
  45. Results indicate that phosphorylation of human DNMT1 by protein kinase C is isoform-specific and provides the first evidence of cooperation between PKCzeta and DNMT1 in the control of the DNA methylation patterns of the genome. PMID: 21619587
  46. human platelets express PKCzeta, and it may be constitutively phosphorylated at the activation loop threonine 410 and the turn motif threonine 560 under basal resting conditions, which are differentially dephosphorylated by outside-in signaling PMID: 21645497
  47. The PKCzeta activation by d-flow induces endothelial cell (EC) apoptosis by regulating p53. PMID: 21624955
  48. that upon DAMGO treatment, MOR activates PKCzeta through a PDK1-dependent signaling pathway to induce CCR5 phosphorylation and desensitization. PMID: 21454526
  49. The prognostic impact of TGF-beta1, NF-kappaB p105, PKC-zeta, Par-6alpha, E-cadherin and vimentin in non-gastrointestinal stromal tumor soft tissue sarcomas, was investigated. PMID: 21390241
  50. low levels of expression are associated with poorly differentiated tumours and a poor outcome in breast cancer patients PMID: 20844151

Show More

Hide All

Subcellular Location
Cytoplasm. Endosome. Cell junction. Membrane; Peripheral membrane protein.; [Isoform 2]: Cytoplasm.
Protein Families
Protein kinase superfamily, AGC Ser/Thr protein kinase family, PKC subfamily
Tissue Specificity
Expressed in brain, and to a lesser extent in lung, kidney and testis.
Database Links

HGNC: 9412

OMIM: 176982

KEGG: hsa:5590

STRING: 9606.ENSP00000367830

UniGene: Hs.496255

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1