Name: Recombinant Human S-phase kinase-associated protein 2 (SKP2)
Brand: CUSABIO
SKU: CSB-EP613392HU

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

SKP2

Uniprot No.

Q13309

Research Area

Cancer

Alternative Names

CDK2/Cyclin A associated protein p45; Cyclin A/CDK2 associated protein p45; Cyclin-A/CDK2-associated protein p45; F box protein Skp2; F box/LRR repeat protein 1; F-box protein Skp2; F-box/LRR-repeat protein 1; FBL 1; FBL1; FBXL 1; FBXL1; FLB 1; FLB1; MGC1366; p45; p45skp2; S phase kinase associated protein 2 (p45); S phase kinase associated protein 2; S-phase kinase-associated protein 2; S-phase kinase-associated protein 2 E3 ubiquitin protein ligase; SKP 2; Skp2; SKP2_HUMAN

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

1-424aa

Target Protein Sequence

MHRKHLQEIPDLSSNVATSFTWGWDSSKTSELLSGMGVSALEKEEPDSENIPQELLSNLGHPESPPRKRLKSKGSDKDFVIVRRPKLNRENFPGVSWDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLWQTLDLTGKNLHPDVTGRLLSQGVIAFRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYLQHLSLSRCYDIIPETLLELGEIPTLKTLQVFGIVPDGTLQLLKEALPHLQINCSHFTTIARPTIGNKKNQEIWGIKCRLTLQKPSCL
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Mol. Weight

63.8kDa

Protein Length

Full Length

Tag Info

N-terminal 6xHis-SUMO-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The expression region of this recombinant Human SKP2 covers amino acids 1-424. The theoretical molecular weight of the SKP2 protein is 63.8 kDa. The SKP2 protein was expressed in e.coli. Fusion of the N-terminal 6xHis-SUMO tag into the SKP2 encoding gene fragment was conducted, allowing for easier detection and purification of the SKP2 protein in subsequent stages.

Human S-phase kinase-associated protein 2 (SKP2) is a key regulator of the cell cycle, specifically the G1 to S phase transition. SKP2 targets cell cycle inhibitors for ubiquitin-mediated degradation, promoting cell cycle progression. Studying SKP2 contributes to insights into cancer biology, cell cycle regulation, and potential therapeutic strategies targeting cell proliferation and differentiation. In cancer research, SKP2 is associated with tumor development and progression. In cell biology, it is crucial to understand cell cycle control. Additionally, SKP2 plays a role in stem cell maintenance.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

■ Q&A

I am interested in CSB-EP613392HU.I would like to know if you can guarantee that this product/protein does not have any large aggregates, and is folded properly? If so, can you provide this evidence?

Thanks for your inquiry! This protein does not contain any large aggregates. The E. coli recombinant expression system won't influence the formation of disulfide bonds. Whether protein can be properly folded is also related to the correct formation of disulfide bonds. If protein can not be folded correctly, inclusion bodies will be formed. The protein we provide is soluble, which has no problem to be folded correctly, which indicates that the presence of disulfide bonds. However, we haven't performed relevant experiment yet, such as mass spectrometry, CD spectrum.

Target Background

Function

Substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins involved in cell cycle progression, signal transduction and transcription. Specifically recognizes phosphorylated CDKN1B/p27kip and is involved in regulation of G1/S transition. Degradation of CDKN1B/p27kip also requires CKS1. Recognizes target proteins ORC1, CDT1, RBL2, KMT2A/MLL1, CDK9, RAG2, FOXO1, UBP43, YTHDF2, and probably MYC, TOB1 and TAL1. Degradation of TAL1 also requires STUB1. Recognizes CDKN1A in association with CCNE1 or CCNE2 and CDK2. Promotes ubiquitination and destruction of CDH1 in a CK1-dependent manner, thereby regulating cell migration.; Through the ubiquitin-mediated proteasomal degradation of hepatitis C virus non-structural protein 5A, has an antiviral activity towards that virus.

Gene References into Functions

MiR-339 targets the 3'-untranslated region of Skp2 mRNA to depress the proliferation of lung cancer cells. PMID: 29377618
Report that YAP is subject to non-proteolytic, K63-linked polyubiquitination by the SCF(SKP2) E3 ligase complex (SKP2), which is reversed by the deubiquitinase OTUD1. The non-proteolytic ubiquitination of YAP enhances its interaction with its nuclear binding partner TEAD, thereby inducing YAP's nuclear localization, transcriptional activity, and growth-promoting function. PMID: 29891922
BTrCP-FBXW2-SKP2 axis forms an oncogene-tumour suppressor-oncogene cascade to control cancer cell growth with FBXW2 acting as a tumour suppressor by promoting SKP2 degradation. PMID: 28090088
Result demonstrated that the overexpression of S-phase kinase-associated protein 2 (Skp2) was closely involved in the resistance of osteosarcoma cells to methotrexate and in the acquirement of EMT properties. PMID: 29620168
The role of USP18 in breast cancer provides a novel insight into the clinical application of the USP18/AKT/Skp2 pathway. PMID: 29749454
SKP2 promotes HCC progression and its nuclear functions of autophagy induction with CARM1 and AMPK, which may provide a potential target for HCC therapy. PMID: 29991055
The results of the present study revealed that miR340 serves a tumor suppressor role by influencing the proliferation, apoptosis, migration and invasion of HCC cell lines, which may be explained by the downregulation of SKP2 by miR340. PMID: 28944918
Our findings revealed that targeting Skp2 could be a promising therapeutic strategy for the treatment of Osteosarcoma PMID: 28627672
Levels of p21 and p27 were decreased in TACO or pAKT overexpressing HCC due to SKP2 upregulation. PMID: 27779207
Skp2 exhibited an oncogenic function in osteosarcoma cells. PMID: 28771075
The results suggest that Skp2 repression is important for sustaining tetraploid G1 arrest after cytokinesis blockade and is required to prevent uncoupled DNA replication and nuclear division without cytokinesis. PMID: 28648144
DCUN1D3 has a role in activating SCFSKP2 ubiquitin E3 ligase activity through cullin-1 neddylation and cell cycle progression in tumor cells with UV damage PMID: 27542266
The expression of p-Skp2 was associated with p-mTOR in GC cell lines and tissues. Interestingly, the combination of p-Skp2 and p-mTOR was a better predictor of survival than either factor alone PMID: 28446188
Atorvastatin strengthens Skp2 binding to FOXO1 or ICAM1, leading to ubiquitination and degradation. Skp2-dependent ubiquitination of major pathogenic molecules is the key mechanism for statin's protective effect on endothelial function in diabetes. PMID: 28802579
we identified that rottlerin exhibited its anti-tumor potential partly through inactivation of Skp2 in breast cancer PMID: 27582552
These findings indicated that SKP2 inhibition sensitized the prolactinoma cells to bromocriptine and helped promote apoptosis. PMID: 27488872
Skp2 suppressed p53 and inhibited PIG3-induced apoptosis, while Skp2B attenuated the function of PIG3 by inhibiting PHB. PMID: 27111245
Data suggest that targeting S-phase kinase associated protein 2 (SKP2) may serve as a potential radiosensitizer for developing effective therapeutic strategies against cervical cancer. PMID: 27317767
Data indicate a positive correlation of Skp2 and MTH1 expression in melanoma cell lines and patient specimens. PMID: 28947420
These results indicated that at least some oncogenic functions of BAG3 were mediated through posttranscriptional regulation of Skp2 via antagonizing suppressive action of miR-21-5p in ovarian cancer cells. PMID: 28624440
High SKP2 expression is associated with Non-Small Cell Lung Cancer. PMID: 28872922
Skp2-mediated degradation of Cygb was identified as the key mechanism for controlling its oscillating levels during the cell cycle. PMID: 28948618
FOXM1 may play a central role in the skp2-cdk1 loop driving tumor progression. PMID: 27684411
simvastatin also increased p21 and p27 expression in tumor sections by reducing Skp2 expression and inducing AMPK activation and STAT3 suppression in the same tumor tissues. PMID: 28230855
Structural mimicry by a bacterial AnkB to human Skp2 hijacks the host ubiquitin-proteasome system. PMID: 28111017
p27 and its cognate ubiquitin ligases, Skp2/KPC/Pirh2, are specifically involved in determining the clinical profiles of lung carcinomas. PMID: 28601655
direct interactions of MAGE-A11 with Skp2 and cyclin A regulate the substrate-specificity of Skp2-mediated protein degradation. PMID: 27720894
abnormal levels of Skp2 and p27(KIP1) have probably been involved in the pathogenesis of ADH and DCIS. Thus, Skp2 and p27(KIP1) may serve as important diagnosis markers PMID: 28514182
High SKP2 expression is associated with lung cancer. PMID: 28789966
our results revealed a novel mechanism in which EZH2 stability is regulated by SKP2 through the TRAF6-mediated and K63-linked ubiquitination, which contributes to elevated levels of H3K27me3 during prostate tumorigenesis and CRPC growth. PMID: 27869166
Data demonstrate that AMPKa2 protein levels are reduced in bladder cancer and that this reduction is correlated with an increase in SKP2 expression with a concomitant reduction in p27 protein levels. PMID: 27638620
SKP2 expression can inhibit radiation induced bystander effect of esophageal cancer cells. The mechanism may function, at least partly, through the regulation of Rad51 in the ability to repair DNA damage. PMID: 28178195
AMPK deficiency results in nuclear CARM1 decrease mediated in part by SKP2, contributing to autophagy dysfunction in the aged heart. PMID: 28315332
Higher expression of Skp2 correlates with lower expression of p27kip1 in gastric cancer tissues. PMID: 27572672
The suppression of Skp2 reduced the enzyme activities of MMP-2. PMID: 26874697
Data suggest that mternally expressed gene 3 (Meg3) long non-coding RNA and microRNA miR-3163 may coordinate suppression of translation of S-phase kinase associated protein 2 (Skp2) mRNA in non-small cell lung cancer (NSCLC) cells to inhibit cell growth. PMID: 26482610
Data suggest that SIRT2 may induce Skp2 deacetylation and subsequent degradation to abolish the effects of Skp2 on p27 to affect NSCLC cell growth. PMID: 26942878
High expression of SKP2 is associated with non-muscle invasive urothelial bladder carcinoma. PMID: 26932430
HDACIs effects on Skp2 protein posttranslational modifications and/or on its removal PMID: 26682002
miR-186 has a suppressive role in esophageal squamous cell carcinoma progression via SKP2-mediated pathway PMID: 26568291
Patients with breast cancer have an increased SKP2 level. Interference in SKP2 gene expression can inhibit breast cancer cell growth. PMID: 26345857
High expression of SKP2 is associated with Advanced Ovarian Cancer. PMID: 26320455
Results demonstrate that curcumin exerts its antitumor activity through inhibition of glioma cell Skp2 pathway. PMID: 26046466
TRUSS is a novel substrate of E3 ligase Skp2. PMID: 26038816
Overexpression of LKB1 and Skp2 is found in hepatocellular carcinoma patients and predicts poor survival outcomes. PMID: 25728766
The Skp2-mH2A1-CDK8 axis has a critical role in breast cancer development via dysregulation of the G2/M transition, polyploidy, cell growth dysregulation, and loss of tumor suppression. PMID: 25818643
the Skp2mediated degradation of p27kip1 was important in the proliferation of tumor cells. The present study, therefore, provided a molecular reference for the treatment of liver cancer. PMID: 25572801
Over-expression of Skp2 resulted in the increased cell growth and number of S phase cells in Skp2 transfected MCF-7 cells PMID: 26429528
Caffeic acid phenethyl ester induced cell cycle arrest and growth inhibition in prostate cancer cells via regulation of Skp2, p53, p21Cip1, and p27Kip1. PMID: 25788262
Particularly for TNBC associated with Skp2/LRP6 overexpression. PMID: 25358452

Hide All

Subcellular Location

Cytoplasm. Nucleus.

Database Links

HGNC: 10901

OMIM: 601436

KEGG: hsa:6502

STRING: 9606.ENSP00000274255

UniGene: Hs.23348

Place an order now

I. Product details

Product name *

Code *

Size *

Quantity *

Message

II. Contact details

Name *

Email address *

Company/Organization

Phone

III. Ship To

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

IV. Bill To Same as Shipping Address