Recombinant Human Toll-like receptor 4(TLR4),partial

Code CSB-EP023603HU1
Size US$2062
The Latest Promotion
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 85% as determined by SDS-PAGE.
Target Names TLR4
Uniprot No. O00206
Research Area Cardiovascular
Alternative Names ARMD10; CD284; CD284 antigen; ESOP 1; ESOP1; Homolog of Drosophila toll; hToll; LY 96; LY96; Lymphocyte antigen 96; md 2; MD 2 protein; MD2 protein; Myeloid differentiation protein 2; Protein MD 2; Protein MD2; TLR 4; TLR4; TLR4_HUMAN; TOLL; Toll like receptor 4; Toll-like receptor 4
Species Homo sapiens (Human)
Source E.coli
Expression Region 27-631aa
Target Protein Sequence EPCVEVVPNITYQCMELNFYKIPDNLPFSTKNLDLSFNPLRHLGSYSFFSFPELQVLDLSRCEIQTIEDGAYQSLSHLSTLILTGNPIQSLALGAFSGLSSLQKLVAVETNLASLENFPIGHLKTLKELNVAHNLIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYCTDLRVLHQMPLLNLSLDLSLNPMNFIQPGAFKEIRLHKLTLRNNFDSLNVMKTCIQGLAGLEVHRLVLGEFRNEGNLEKFDKSALEGLCNLTIEEFRLAYLDYYLDDIIDLFNCLTNVSSFSLVSVTIERVKDFSYNFGWQHLELVNCKFGQFPTLKLKSLKRLTFTSNKGGNAFSEVDLPSLEFLDLSRNGLSFKGCCSQSDFGTTSLKYLDLSFNGVITMSSNFLGLEQLEHLDFQHSNLKQMSEFSVFLSLRNLIYLDISHTHTRVAFNGIFNGLSSLEVLKMAGNSFQENFLPDIFTELRNLTFLDLSQCQLEQLSPTAFNSLSSLQVLNMSHNNFFSLDTFPYKCLNSLQVLDYSLNHIMTSKKQELQHFPSSLAFLNLTQNDFACTCEHQSFLQWIKDQRQLLVEVERMECATPSDKQGMPVLSLNITCQMNK
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 72.4 kDa
Protein Length Partial
Tag Info N-terminal 10xHis-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Cooperates with LY96 and CD14 to mediate the innate immune response to bacterial lipopolysaccharide (LPS)
Gene References into Functions
  1. the presence of polymorphism Asp299Gly gene TLR4 in patients co-infected with HIV/HCV indicates a high risk of metabolic disturbances PMID: 30204113
  2. high expression of (TLR4) is associated with Type 2 diabetes mellitus. PMID: 30403590
  3. Data suggest that the toll-like receptor 4 (TLR4) mutant-specific conformational alterations may help in deciphering the mechanism of loss-of-function mutations. PMID: 28272553
  4. TLR4 and TLR9 mRNA were elevated in blood samples from celiac disease patients compared to the healthy controls PMID: 30057921
  5. high TLR4 expression level during acute rejection was associated with adverse kidney allograft outcome PMID: 29475090
  6. the results of the present study showed significantly higher mRNA expression levels for TLR4 180days post-transplantation in the graft dysfunction group compared to well functioning graft group PMID: 29452169
  7. the expression levels of TLR4/MyD88 were positively correlated with the metastatic potential of breast cancer cells and tumors. The expression levels of TLR4/MyD88 may be used as a biomarker to evaluate the prognosis and guide the treatment of patients with breast cancer. PMID: 30066873
  8. These results suggest that celastrol exerts its protective effect partly via inhibiting the TLR4mediated immune and inflammatory response in steatotic HepG2 cells. PMID: 30015859
  9. No association between the SNPs rs10983755 A/G, rs4986791 C/T, rs4986790 A/G, rs10759932 C/T, rs1927911 C/T, rs11536889 C/G, and rs12377632 C/T and heart transplant rejection was found PMID: 30177119
  10. The results revealed that TLR4 and COX-2 were upregulated in PCa tissues; silencing of TLR4 or COX-2 inhibited PCa cell proliferation, migration, and invasion. PMID: 30098292
  11. The role of IDO1-IDO2-AHR pathway in the TLR4-induced tolerogenic phenotype in human dendritic cells has been reported. PMID: 28256612
  12. TLR4 Asp299Gly polymorphism potentially leading to the development of recurrent hydatidosis, by skewing the immune system towards a Th2 response PMID: 29602972
  13. Study demonstrated that HMGB1 and TLR4 could contribute to the inflammatory lichen planus process in skin. PMID: 29728859
  14. Physical interaction between p38 and eNOS was demonstrated by immunoprecipitation, suggesting a novel, NO-independent mechanism for eNOS regulation of TLR4. In correlation, biopsy samples in patients with systemic lupus erythematous showed reduced eNOS expression with associated elevations in TLR4 and p38, suggesting an in vivo link. PMID: 29061842
  15. The overexpression of miR-140 inhibited the upregulation of the expression of TLR4. PMID: 29901170
  16. TLR4 small interfering RNA blocked hUGT1A1/hNRs downregulation. PMID: 29311138
  17. The expression of TLR4 in perihematoma tissue began to increase within 6 hours after intracerebral hemorrhage and decreased after 72 hours. PMID: 29990607
  18. miR-20a could negatively regulate TLR4 and NLRP3 signaling to protect human aortic endothelial cells from inflammatory injuries. PMID: 29653364
  19. Study provides clear evidence that resistin is a clinically relevant endogenous ligand for TLR4, which promotes tumor progression via TLR4/NF-kappaB/STAT3 signaling. PMID: 28991224
  20. The antitumor effect of curcumin was related to the inhibition HSP70-TLR4 signaling. PMID: 29901164
  21. Activates the NFkappaB pathway through the Tolllike receptor 4 (TLR4)/myeloid differentiation factor 88 (MyD88)/IkappaBalpha axis. PMID: 29916535
  22. An MRP-TLR4 dependent signaling may play an important role in the pathogenesis of autoimmune thyroid diseases. PMID: 29656212
  23. The pathways involved in the effect of ROCK1 in human corneal epithelial cells was preliminarily explained by detecting changes of TLR4-mediated NF-kB and ERK signaling. PMID: 29804125
  24. Serum TLR4 was closely related to AA and associated with some AA-related circulating markers PMID: 29649455
  25. Fibrinogen induced podocyte injury via the TLR4-p38 MAPK-NF-kappaB p65 pathway in focal segmental glomerulosclerosis. PMID: 28407405
  26. Crosstalk between TLR4 and Notch1 signaling regulates the inflammatory response in the IgAN and maybe plays an important role in the progression of IgAN. PMID: 29230705
  27. Data indicate three sites within tenascin-C that directly and cooperatively interact with toll-like receptor 4 (TLR4). PMID: 29150600
  28. Low TLR4 expression is associated with pancreatic ductal adenocarcinoma. PMID: 30246618
  29. An association exists between P. gingivalis and P. intermedia with increased TLR-4 and NF-kappaB expression in the placenta of pre-eclamptic women with periodontitis. PMID: 28349674
  30. TLR4 SNPs were not associated with acute graft rejection in kidney transplant recipients. PMID: 28411360
  31. TLR4 Thr399Ile polymorphism was associated with increased risk of Crohn's disease in Asia and Asians. [meta-analysis] PMID: 29421805
  32. Our results indicated TLR4 SNP rs11536889 may be a marker for intracranial aneurysm risk PMID: 29754966
  33. the expression of TLR4 in gingival tissues and on mast cells increased with the severity of chronic periodontitis, suggesting that TLR4, particularly mast cell TLR4, may be important in the disease process of human chronic periodontitis. PMID: 29488617
  34. Report shows that rheumatoid arthritis (RA) patients express functional TLR4 on peripheral CD8+ T cells that directly promote T-cell function and differentiation to Tc1. The study also suggests that TLR4 signals directly drive Tc1 development and T cell activation independent of TCR engagement. PMID: 28424490
  35. Resistin promoted lung adenocarcinoma metastasis through the TLR4/Src/EGFR/PI3K/NF-kappaB pathway. PMID: 29927028
  36. imcreased TLR4 expression in gastric cardia lesions may be associated with gastric cardia cancer tumorigenesis PMID: 29670922
  37. The immunoenhancement effect of PSP against lung cancer is mediated by TLR4-MAPK/NF-kappaB signaling pathways PMID: 29343453
  38. LPS stimulation induced TLR4 expression and increased pigmentation. TLR4 expression was not detected after single-dose UVA or UVB treatment, but pigmentation increased. Repeated UV treatment induced TLR4 expression and increased pigmentation. LPS stimulation and repeated UV treatment increased IL-6 secretion, and repeated UVB treatment increased IL-10 secretion. PMID: 29063638
  39. data suggest that high-phosphate conditions directly induce vascular calcification via the activation of TLR4/NF-kappaB signaling in VSMCs PMID: 29227975
  40. LncRNA MEG3 ameliorates respiratory syncytial virus infection by suppressing TLR4 signaling. PMID: 29257348
  41. Study shows that the toll-like receptor 4 gene rs1927914 polymorphism was associated with susceptibility to ischemic stroke in males. Moreover, the rs10759932 polymorphism may affect inflammatory response in ischemic stroke patients. PMID: 29075930
  42. There was no difference found in MMP-2, MMP-9 or TLR-4 levels between non-thrombocytopenic and thrombocytopenic septic donors. PLA formation was increased in thrombocytopenic patients. PMID: 29734352
  43. there was a negative correlation between YKL-40 and TLR4 expression in chronic sinusitis patients with nasal polyps. YKL-40 and TLR4 interacted with each other to activate NF-kappaB and promote disease progression. PMID: 29921378
  44. High expression of MMP-9 and TLR4 in patients with COPD may promote inflammatory cell infiltration, induce proliferation of smooth muscle cells, degrade extracellular matrix, and play an important role in lung revascularization. PMID: 28537664
  45. our findings confirm that in south Tunisian patients with IBD, the TLR4-Thr399Ile variant is strongly associated with susceptibility to CD and that the two polymorphisms of this receptor (TLR4-Thr399Ile and TLR4-Asp299Gly) may play a role in the clinical expression of UC. PMID: 29055077
  46. Logistic analysis showed that both rs11536889 and rs7873784 in TLR4 were associated with risk of type-2 diabetes mellitus (T2DM) complicated by tuberculosis (TB) (T2DMTB) in additive and dominant models. Carriers with homozygous and heterozygous mutants of rs11536889 and rs7873784 were associated with higher T2DMTB risk than those with wild-type homozygotes PMID: 29073942
  47. Involvement of the TLR-4 in the mediation of the biglycan action was confirmed using a specific silent agent (siRNA). Taken together, these data could be used to develop new anti-inflammatory approaches PMID: 29339093
  48. TLR4 was significantly up-regulated in synovial tissue samples from rheumatoid arthritis patients. PMID: 28987944
  49. The results revealed a lack of association for TLR4 variant with ischemic stroke and hemorrhagic stroke, although a significant association was observed with the subtypes extracranial large artery. PMID: 28963650
  50. TREM-2 promotes acquired cholesteatoma-induced bone destruction by modulating TLR4 signaling pathway and osteoclasts activation PMID: 27934908
  51. The literature suggests that hyperhomocysteinemia promotes TLR-4-driven chronic vascular inflammation and mitochondria-mediated cell death inducing peripheral vascular remodeling. PMID: 28386844
  52. hRetn binds the LPS receptor Toll-like receptor 4 (TLR4) through its N terminal and modulates STAT3 and TBK1 signaling, triggering a switch from proinflammatory to anti-inflammatory responses. PMID: 29133417
  53. palmitate-induced apoptosis of vascular smooth muscle cell depends on the activation of the pathway involving TLR4, ROS and p53 PMID: 28609685
  54. These data suggest that TLR4 gene polymorphism rs11536889 may play a prominent role in hepatitis A disease susceptibility and TLR4 expression in population from Assam. PMID: 29521104
  55. TLR 4 rs1927914 polymorphism was associated with the decreased susceptibility to Henoch-Schonlein purpura (HSP) in the Chinese children. PMID: 28905155
  56. The TLR4 Asp299Gly SNP significantly interacted with P. gingivalis in conferring a decreased risk of periodontitis and may be protective against alveolar bone height loss, a feature of periodontitis. PMID: 26174031
  57. Studied toll-like receptor 4 (TLR4) and MicroRNA-155 (miR-155) expression and inflammatory cytokine secretion after lipopolysaccharide stimulation in peripheral blood mononuclear cells from coronary artery disease patients. PMID: 28407320
  58. the formation of Ni(II) complexes with the model peptide NH2-FQHSNRKQMSERSVFRSRRNRIYRDISHTHTR-COO(-), which encompasses the sequence 429-460 of hTLR4, is reported. PMID: 28965571
  59. The results of this meta-analysis suggest that the rs4986790 and rs4986791 polymorphisms in toll like receptor 4 gene may have no statistically significant influence on sepsis susceptibility. PMID: 27958344
  60. Chronic kidney disease promotes muscle inflammation through an up-regulation of TLR4, which may activate downward inflammatory signals such as TNF-alpha and NFkB-regulated genes. PMID: 27897392
  61. These unprecedented data suggest that IRF1 and NF-kappaB orchestrate the TLR4-primed immunomodulatory response of hMSCs and that this response also involves the PI3K pathway. PMID: 27444640
  62. TLR4 and miR-146b levels were significantly associated with chronic kidney disease-mineral bone disorder (CKD-MBD). TLR4 levels were significantly downregulated, whereas primiR-146b and miR-146b were upregulated in the presence of uremic toxins in human Saos-2 osteoblast-like cells. PMID: 28623542
  63. sTLR4/MD-2 complex inhibits colorectal cancer migration and invasiveness in vitro and in vivo by lncRNA H19 down-regulation. PMID: 29036538
  64. we found that expression of TLR4 on monocytes was decreased in active ITP patients and correlated positively with platelets count. PMID: 28412855
  65. Genetic polymorphisms of IL-17 and TLR4 may play a role in host susceptibility to tuberculosis. PMID: 27339100
  66. Results show that TLR4 binds to HMGB1 when released from necrotic or hyperexcitatory neurons to trigger the specific phosphorylation of MARCKS via MAP kinases, and induces neurite degeneration, the classical hallmark of Alzheimer's disease. PMID: 27557632
  67. TLR4 is highly expressed in human myocarditis responding to immunosuppression. It can be considered as a new sensitive marker in patient selection predicting a good response to immunosuppressive therapy. PMID: 28370906
  68. these results demonstrate that sB7-H3 promotes invasion and metastasis through the TLR4/NF-kappaB pathway in pancreatic carcinoma PMID: 27273624
  69. Clathrithromycin suppressed TLR4-mediated MCP-1 production in human mesangial cells. PMID: 27614743
  70. Authors report that activation of Toll-like receptor 4 (TLR4) in macrophages causes lanosterol, the first sterol intermediate in the cholesterol biosynthetic pathway, to accumulate. PMID: 28658622
  71. These findings suggest that TLR4 methylation may be protective against the damage conferred by alcohol use disorders on precuneus and inferior parietal gray matter PMID: 28930057
  72. Bronchial epithelial overexpression of TLR4 and NOD1 in severe/very severe stable COPD, associated with increased bronchial inflammation and P. aeruginosa bacterial load, may play a role in the pathogenesis of COPD PMID: 28536249
  73. Authors firstly uncovered that TLR4/NFkappaB mediated inflammation signaling and miR-146a participated in ART-related preterm birth patients, which suggests that importance of TLR4/NFkappaB/miR-146a signaling in clinical interventions and biomarkers of ART-related perinatal or neonatal outcomes. PMID: 27636999
  74. Expression of X-linked Toll-like receptor 4 signaling gene IRAK1 was significantly elevated in female neonates vs. male neonates. PMID: 28060792
  75. Prolonged hypertension influences peripheral monocyte TLR4 expression and IL-17A serum levels PMID: 28359064
  76. TLR4-stimulated oral keratinocytes inhibited the proliferation of oral lichen planus CD4(+) T cells and CD8(+) T cells, and simultaneously prompted their apoptosis. PMID: 27762043
  77. Reduced expression of caveolin-1 in monocytes could aggravate the TLR4-mediated inflammatory cascade PMID: 27981790
  78. the role of TLR4 in angiogenesis could be of value in various settings related to tissue repair and tissue engineering. Moreover, since LPS and TLR4 agonists improve angiogenesis and osteogenesis, TLR4 agonists (endogenous or synthetic) could be used for angiogenesis intervention in vivo. PMID: 26205614
  79. PTX treatment of THP-1 macrophages for 1 h induced marked intranuclear translocation of NF-kappaB p65. Low-dose PTX inhibited the M2 phenotype and induced the M1 phenotype via TLR4 signaling, suggesting that low-dose PTX can alter the macrophage phenotype, whereas clinical doses can kill cancer cells. These results suggest that the anticancer effects of PTX are due both to its cytotoxic and immunomodulatory activities PMID: 28440494
  80. Upregulation of TLR-4 on CD14(++)CD16(+)monocytes might be associated with coronary plaque vulnerability in patients with stable angina pectoris. PMID: 28344199
  81. assess the role of TLR2 and TLR4 gene expression as an early marker for the risk of doxorubicin-induced cardiomyopathy in PMID: 28256509
  82. MD-2 siRNA or plasmid further confirmed the efficacy of Iturin A by suppressing MD-2/TLR4 signaling pathway. The in silico docking study showed that the Iturin A interacted well with the MD-2 in MD-2/TLR4 receptor complex. Conclusively, inhibition of MD-2/TLR4 complex with Iturin A offered strategic advancement in cancer therapy. PMID: 28347875
  83. our study suggests that ninjurin2 is a novel regulator of endothelia inflammation and activation through TLR4 signaling pathways, and these data provided new insights into the mechanisms between NINJ2 and atherosclerosis. PMID: 28431986
  84. TLR4 rs11536889 polymorphism is a novel genetic factor in the development of coronary artery disease (CAD), influencing the extent and severity of CAD. PMID: 28002812
  85. TLR4 polymorphism is associated with Toxoplasma gondii infection. PMID: 28500897
  86. data confirm that engineered human cells expressing TLR4, MD2 and CD14 can respond to CMP with NF-kappaB activation and the response can be influenced by variations in CMP-mannosylation PMID: 29281684
  87. RBP4-induced inflammation is largely mediated by TLR4. PMID: 28400700
  88. novel observation that sCD14 compared with lipopolysaccharide binding protein, offers a preferred target to ameliorate TLR especially TLR4-induced inflammation and insulin resistance in human obesity and metabolic syndrome PMID: 26880233
  89. For asthma, there was suggestive evidence of a gene-by-environment interaction for the CD14 variant rs2569190 (Interaction P = 0.16) but not for the TLR4 variants rs4986790 and rs4986791. PMID: 27977294
  90. Toll-like receptor 4 may have a role in non-small cell lung cancer PMID: 27223258
  91. essential role of TLR4/ROS/miR-21 pathway in LPS-induced outgrowth of primary human lung cancer PMID: 27286259
  92. An association with IL-1beta-511 locus and IL-1beta-511-TLR4-896 diplotype (CC-AA) and Type 2 Diabetes Mellitus is discussed. PMID: 28620993
  93. TLR4 Thr399Ile polymorphism along with H. pylori infection may play critical roles in peptic ulcer development in North of Iran. PMID: 29135054
  94. Human neutrophil elastase is involved in transactivation of TLR4 through activation of DUOX-2/EGFR and synergistically enhances IL-12p40 production by macrophages stimulated with LPS. PMID: 27282560
  95. Data show that inhibition of MAPK pathway by peroxisome proliferator-activated receptor gemma (PPARg) agonist rosiglitazone (RGZ) requires Toll-like receptor 4 (TLR4). PMID: 27323819
  96. In cells expressing only CD36 suggests that TLR4 expression provides the cells with additional mechanisms to mediate lipid uptake. Our results indicate that TLR4 can mediate the internalization of saturated fatty acids, and of unsaturated fatty acids in presence of CD36. PMID: 28500692
  97. An essential role of the TLR4 pathway and chronic inflammation in KSHV-induced tumorigenesis, which helps explain why HIV-infected patients, who frequently suffer from opportunistic bacterial infections and metabolic complications, frequently develop Kaposi sarcoma. PMID: 29051178
  98. The present study reveals that TLR4 drives the production of TNFalpha and IL-10 induced by L. braziliensis amastigotes and that the parasites decrease TLR4 expression on monocyte surface. PMID: 27649507
  99. The newest research investigating Angiotensin II triggering toll like receptor 4 activation in the kidney, vasculature and central nervous system contributing to hypertension are reviewed. [review] PMID: 28330785
  100. Data suggest that endosomal localization of TICAM2 is essential for TLR4-mediated type I interferon-inducing signaling from endosomes; TICAM2 acts as scaffold protein and activates TICAM1; N-terminal myristoylation allows TICAM2 to anchor to endosomal membrane. (TICAM2 = toll like receptor adaptor molecule-2; TICAM1 = toll like receptor adaptor molecule-1; TLR4 = toll-like receptor 4) [REVIEW] PMID: 28630139

Show More

Hide All

Subcellular Location Cell membrane, Single-pass type I membrane protein, Early endosome
Protein Families Toll-like receptor family
Tissue Specificity Highly expressed in placenta, spleen and peripheral blood leukocytes (PubMed:9435236, PubMed:9237759). Detected in monocytes, macrophages, dendritic cells and several types of T-cells (PubMed:9237759, PubMed:27022195).
Database Links

HGNC: 11850

OMIM: 603030

KEGG: hsa:7099

STRING: 9606.ENSP00000363089

UniGene: Hs.174312

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1