Recombinant Human Toll-like receptor 4 (Tlr4), partial

In Stock
Code CSB-BP023603HU1
Abbreviation Recombinant Human TLR4 protein, partial
MSDS
Size $528
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cardiovascular
Alternative Names
ARMD10; CD284; CD284 antigen; ESOP 1; ESOP1; Homolog of Drosophila toll; hToll; LY 96; LY96; Lymphocyte antigen 96; md 2; MD 2 protein; MD2 protein; Myeloid differentiation protein 2; Protein MD 2; Protein MD2; TLR 4; TLR4; TLR4_HUMAN; TOLL; Toll like receptor 4; Toll-like receptor 4
Species
Homo sapiens (Human)
Source
Baculovirus
Expression Region
27-631aa
Target Protein Sequence
EPCVEVVPNITYQCMELNFYKIPDNLPFSTKNLDLSFNPLRHLGSYSFFSFPELQVLDLSRCEIQTIEDGAYQSLSHLSTLILTGNPIQSLALGAFSGLSSLQKLVAVETNLASLENFPIGHLKTLKELNVAHNLIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYCTDLRVLHQMPLLNLSLDLSLNPMNFIQPGAFKEIRLHKLTLRNNFDSLNVMKTCIQGLAGLEVHRLVLGEFRNEGNLEKFDKSALEGLCNLTIEEFRLAYLDYYLDDIIDLFNCLTNVSSFSLVSVTIERVKDFSYNFGWQHLELVNCKFGQFPTLKLKSLKRLTFTSNKGGNAFSEVDLPSLEFLDLSRNGLSFKGCCSQSDFGTTSLKYLDLSFNGVITMSSNFLGLEQLEHLDFQHSNLKQMSEFSVFLSLRNLIYLDISHTHTRVAFNGIFNGLSSLEVLKMAGNSFQENFLPDIFTELRNLTFLDLSQCQLEQLSPTAFNSLSSLQVLNMSHNNFFSLDTFPYKCLNSLQVLDYSLNHIMTSKKQELQHFPSSLAFLNLTQNDFACTCEHQSFLQWIKDQRQLLVEVERMECATPSDKQGMPVLSLNITCQMNK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
69.8
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human Toll-like receptor 4 (TLR4) is produced through a baculovirus expression system and spans amino acids 27 to 631, representing a partial protein length. The protein carries an N-terminal 6xHis tag and shows purity levels exceeding 85% when analyzed by SDS-PAGE. This preparation is intended solely for research purposes and may serve as a dependable tool across different experimental setups.

Toll-like receptor 4 (TLR4) appears to be a crucial player in the innate immune system, best known for its ability to recognize lipopolysaccharides from Gram-negative bacteria. As a transmembrane protein, it seems to help activate immune cell signaling cascades that trigger inflammatory responses. TLR4 has drawn considerable research interest because of its central role in innate immunity and its apparent involvement in numerous inflammatory conditions.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Human TLR4 is a complex transmembrane pattern recognition receptor whose extracellular domain (27-631aa) requires precise folding, proper leucine-rich repeat (LRR) domain formation, and correct disulfide bonding for ligand recognition and co-receptor binding. The baculovirus-insect cell expression system provides a eukaryotic environment that supports proper protein folding, disulfide bond formation, and some glycosylation modifications. However, TLR4 functionality critically depends on its partnership with MD-2 and proper dimerization, which this partial extracellular domain fragment may not fully support. While the expression system increases folding probability, the absence of the transmembrane and intracellular domains, combined with the N-terminal 6xHis-tag potentially interfering with the N-terminal structural organization, necessitates experimental validation to confirm structural integrity and ligand-binding capability.

1. Protein-Protein Interaction Studies

This application carries significant limitations due to the complex nature of TLR4 interactions. Functional TLR4 requires MD-2 co-receptor association and proper dimerization for ligand binding. The extracellular domain fragment (27-631aa) lacks the transmembrane domain necessary for native conformational constraints, and the N-terminal His-tag may sterically interfere with the MD-2 binding site. Without validation of correct LRR domain folding and MD-2 binding capability, interaction studies may yield false negatives or identify non-physiological binding partners.

2. Antibody Development and Characterization

This application is highly suitable as antibody generation primarily depends on linear epitope availability rather than functional protein conformation. The extracellular domain fragment provides comprehensive antigenic coverage of the LRR regions, making it ideal for generating antibodies targeting the ligand-binding domain. The high purity (>85%) ensures minimal immune responses to contaminants, and the His-tag facilitates efficient purification during antibody production and screening processes.

3. Structural and Biophysical Analysis

These studies are essential priority applications for determining the folding quality and structural integrity of the protein itself, not the native TLR4. Techniques should include circular dichroism spectroscopy to assess secondary structure content of LRR domains, size-exclusion chromatography with multi-angle light scattering to evaluate oligomeric state, and thermal shift assays to determine stability. However, the tags may interfere with crystallization for high-resolution structural studies.

4. Pull-Down Assays and Co-Immunoprecipitation Studies

This application requires rigorous validation due to TLR4's dependency on co-receptors. The extracellular domain may not form proper complexes with MD-2, potentially leading to artifactual interactions. If correctly folded and validated for MD-2 binding (verified), it may be suitable for controlled interaction studies. If unverified, there is a high risk of identifying non-physiological binding partners that do not reflect native TLR4 signaling complexes.

Final Recommendation & Action Plan

The baculovirus-expressed TLR4 extracellular domain fragment is suitable for structural characterization and antibody development but has significant limitations for functional studies due to its partial nature and co-receptor dependency. Begin with Application 3 (Structural and Biophysical Analysis) to validate folding quality through CD spectroscopy, SEC-MALS, and MD-2 binding assays. Application 2 (Antibody Development) can proceed immediately. For Applications 1 and 4 (interaction studies), first confirm MD-2 binding capability and compare results with full-length TLR4 systems. Always include appropriate controls: validate key findings with full-length receptor systems, use known ligands as positive controls, and consider the fragment's limitations in data interpretation.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Cooperates with LY96 and CD14 to mediate the innate immune response to bacterial lipopolysaccharide (LPS). Acts via MYD88, TIRAP and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. Also involved in LPS-independent inflammatory responses triggered by free fatty acids, such as palmitate, and Ni(2+). Responses triggered by Ni(2+) require non-conserved histidines and are, therefore, species-specific. Both M.tuberculosis HSP70 (dnaK) and HSP65 (groEL-2) act via this protein to stimulate NF-kappa-B expression. In complex with TLR6, promotes sterile inflammation in monocytes/macrophages in response to oxidized low-density lipoprotein (oxLDL) or amyloid-beta 42. In this context, the initial signal is provided by oxLDL- or amyloid-beta 42-binding to CD36. This event induces the formation of a heterodimer of TLR4 and TLR6, which is rapidly internalized and triggers inflammatory response, leading to the NF-kappa-B-dependent production of CXCL1, CXCL2 and CCL9 cytokines, via MYD88 signaling pathway, and CCL5 cytokine, via TICAM1 signaling pathway, as well as IL1B secretion. Binds electronegative LDL (LDL(-)) and mediates the cytokine release induced by LDL(-). Stimulation of monocytes in vitro with M.tuberculosis PstS1 induces p38 MAPK and ERK1/2 activation primarily via TLR2, but also partially via this receptor. Activated by the signaling pathway regulator NMI which acts as damage-associated molecular patterns (DAMPs) in response to cell injury or pathogen invasion, therefore promoting nuclear factor NF-kappa-B activation.
Gene References into Functions
  1. the presence of polymorphism Asp299Gly gene TLR4 in patients co-infected with HIV/HCV indicates a high risk of metabolic disturbances PMID: 30204113
  2. high expression of (TLR4) is associated with Type 2 diabetes mellitus. PMID: 30403590
  3. Data suggest that the toll-like receptor 4 (TLR4) mutant-specific conformational alterations may help in deciphering the mechanism of loss-of-function mutations. PMID: 28272553
  4. TLR4 and TLR9 mRNA were elevated in blood samples from celiac disease patients compared to the healthy controls PMID: 30057921
  5. high TLR4 expression level during acute rejection was associated with adverse kidney allograft outcome PMID: 29475090
  6. the results of the present study showed significantly higher mRNA expression levels for TLR4 180days post-transplantation in the graft dysfunction group compared to well functioning graft group PMID: 29452169
  7. the expression levels of TLR4/MyD88 were positively correlated with the metastatic potential of breast cancer cells and tumors. The expression levels of TLR4/MyD88 may be used as a biomarker to evaluate the prognosis and guide the treatment of patients with breast cancer. PMID: 30066873
  8. These results suggest that celastrol exerts its protective effect partly via inhibiting the TLR4mediated immune and inflammatory response in steatotic HepG2 cells. PMID: 30015859
  9. No association between the SNPs rs10983755 A/G, rs4986791 C/T, rs4986790 A/G, rs10759932 C/T, rs1927911 C/T, rs11536889 C/G, and rs12377632 C/T and heart transplant rejection was found PMID: 30177119
  10. The results revealed that TLR4 and COX-2 were upregulated in PCa tissues; silencing of TLR4 or COX-2 inhibited PCa cell proliferation, migration, and invasion. PMID: 30098292
  11. The role of IDO1-IDO2-AHR pathway in the TLR4-induced tolerogenic phenotype in human dendritic cells has been reported. PMID: 28256612
  12. TLR4 Asp299Gly polymorphism potentially leading to the development of recurrent hydatidosis, by skewing the immune system towards a Th2 response PMID: 29602972
  13. Study demonstrated that HMGB1 and TLR4 could contribute to the inflammatory lichen planus process in skin. PMID: 29728859
  14. Physical interaction between p38 and eNOS was demonstrated by immunoprecipitation, suggesting a novel, NO-independent mechanism for eNOS regulation of TLR4. In correlation, biopsy samples in patients with systemic lupus erythematous showed reduced eNOS expression with associated elevations in TLR4 and p38, suggesting an in vivo link. PMID: 29061842
  15. The overexpression of miR-140 inhibited the upregulation of the expression of TLR4. PMID: 29901170
  16. TLR4 small interfering RNA blocked hUGT1A1/hNRs downregulation. PMID: 29311138
  17. The expression of TLR4 in perihematoma tissue began to increase within 6 hours after intracerebral hemorrhage and decreased after 72 hours. PMID: 29990607
  18. miR-20a could negatively regulate TLR4 and NLRP3 signaling to protect human aortic endothelial cells from inflammatory injuries. PMID: 29653364
  19. Study provides clear evidence that resistin is a clinically relevant endogenous ligand for TLR4, which promotes tumor progression via TLR4/NF-kappaB/STAT3 signaling. PMID: 28991224
  20. The antitumor effect of curcumin was related to the inhibition HSP70-TLR4 signaling. PMID: 29901164
  21. Activates the NFkappaB pathway through the Tolllike receptor 4 (TLR4)/myeloid differentiation factor 88 (MyD88)/IkappaBalpha axis. PMID: 29916535
  22. An MRP-TLR4 dependent signaling may play an important role in the pathogenesis of autoimmune thyroid diseases. PMID: 29656212
  23. The pathways involved in the effect of ROCK1 in human corneal epithelial cells was preliminarily explained by detecting changes of TLR4-mediated NF-kB and ERK signaling. PMID: 29804125
  24. Serum TLR4 was closely related to AA and associated with some AA-related circulating markers PMID: 29649455
  25. Fibrinogen induced podocyte injury via the TLR4-p38 MAPK-NF-kappaB p65 pathway in focal segmental glomerulosclerosis. PMID: 28407405
  26. Crosstalk between TLR4 and Notch1 signaling regulates the inflammatory response in the IgAN and maybe plays an important role in the progression of IgAN. PMID: 29230705
  27. Data indicate three sites within tenascin-C that directly and cooperatively interact with toll-like receptor 4 (TLR4). PMID: 29150600
  28. Low TLR4 expression is associated with pancreatic ductal adenocarcinoma. PMID: 30246618
  29. An association exists between P. gingivalis and P. intermedia with increased TLR-4 and NF-kappaB expression in the placenta of pre-eclamptic women with periodontitis. PMID: 28349674
  30. TLR4 SNPs were not associated with acute graft rejection in kidney transplant recipients. PMID: 28411360
  31. TLR4 Thr399Ile polymorphism was associated with increased risk of Crohn's disease in Asia and Asians. [meta-analysis] PMID: 29421805
  32. Our results indicated TLR4 SNP rs11536889 may be a marker for intracranial aneurysm risk PMID: 29754966
  33. the expression of TLR4 in gingival tissues and on mast cells increased with the severity of chronic periodontitis, suggesting that TLR4, particularly mast cell TLR4, may be important in the disease process of human chronic periodontitis. PMID: 29488617
  34. Report shows that rheumatoid arthritis (RA) patients express functional TLR4 on peripheral CD8+ T cells that directly promote T-cell function and differentiation to Tc1. The study also suggests that TLR4 signals directly drive Tc1 development and T cell activation independent of TCR engagement. PMID: 28424490
  35. Resistin promoted lung adenocarcinoma metastasis through the TLR4/Src/EGFR/PI3K/NF-kappaB pathway. PMID: 29927028
  36. imcreased TLR4 expression in gastric cardia lesions may be associated with gastric cardia cancer tumorigenesis PMID: 29670922
  37. The immunoenhancement effect of PSP against lung cancer is mediated by TLR4-MAPK/NF-kappaB signaling pathways PMID: 29343453
  38. LPS stimulation induced TLR4 expression and increased pigmentation. TLR4 expression was not detected after single-dose UVA or UVB treatment, but pigmentation increased. Repeated UV treatment induced TLR4 expression and increased pigmentation. LPS stimulation and repeated UV treatment increased IL-6 secretion, and repeated UVB treatment increased IL-10 secretion. PMID: 29063638
  39. data suggest that high-phosphate conditions directly induce vascular calcification via the activation of TLR4/NF-kappaB signaling in VSMCs PMID: 29227975
  40. LncRNA MEG3 ameliorates respiratory syncytial virus infection by suppressing TLR4 signaling. PMID: 29257348
  41. Study shows that the toll-like receptor 4 gene rs1927914 polymorphism was associated with susceptibility to ischemic stroke in males. Moreover, the rs10759932 polymorphism may affect inflammatory response in ischemic stroke patients. PMID: 29075930
  42. There was no difference found in MMP-2, MMP-9 or TLR-4 levels between non-thrombocytopenic and thrombocytopenic septic donors. PLA formation was increased in thrombocytopenic patients. PMID: 29734352
  43. there was a negative correlation between YKL-40 and TLR4 expression in chronic sinusitis patients with nasal polyps. YKL-40 and TLR4 interacted with each other to activate NF-kappaB and promote disease progression. PMID: 29921378
  44. High expression of MMP-9 and TLR4 in patients with COPD may promote inflammatory cell infiltration, induce proliferation of smooth muscle cells, degrade extracellular matrix, and play an important role in lung revascularization. PMID: 28537664
  45. our findings confirm that in south Tunisian patients with IBD, the TLR4-Thr399Ile variant is strongly associated with susceptibility to CD and that the two polymorphisms of this receptor (TLR4-Thr399Ile and TLR4-Asp299Gly) may play a role in the clinical expression of UC. PMID: 29055077
  46. Logistic analysis showed that both rs11536889 and rs7873784 in TLR4 were associated with risk of type-2 diabetes mellitus (T2DM) complicated by tuberculosis (TB) (T2DMTB) in additive and dominant models. Carriers with homozygous and heterozygous mutants of rs11536889 and rs7873784 were associated with higher T2DMTB risk than those with wild-type homozygotes PMID: 29073942
  47. Involvement of the TLR-4 in the mediation of the biglycan action was confirmed using a specific silent agent (siRNA). Taken together, these data could be used to develop new anti-inflammatory approaches PMID: 29339093
  48. TLR4 was significantly up-regulated in synovial tissue samples from rheumatoid arthritis patients. PMID: 28987944
  49. The results revealed a lack of association for TLR4 variant with ischemic stroke and hemorrhagic stroke, although a significant association was observed with the subtypes extracranial large artery. PMID: 28963650
  50. TREM-2 promotes acquired cholesteatoma-induced bone destruction by modulating TLR4 signaling pathway and osteoclasts activation PMID: 27934908

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type I membrane protein. Early endosome. Cell projection, ruffle.
Protein Families
Toll-like receptor family
Tissue Specificity
Highly expressed in placenta, spleen and peripheral blood leukocytes. Detected in monocytes, macrophages, dendritic cells and several types of T-cells.
Database Links

HGNC: 11850

OMIM: 603030

KEGG: hsa:7099

STRING: 9606.ENSP00000363089

UniGene: Hs.174312

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*