Recombinant Human Tumor necrosis factor receptor superfamily member 10B (TNFRSF10B), partial (Active)

In Stock
Code CSB-MP023965HU1
Abbreviation Recombinant Human TNFRSF10B protein, partial (Active)
MSDS
Size $102
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Human TNFRSF10B at 2 μg/ml can bind Anti-TNFRSF10B recombinant antibody (CSB-RA023965MA2HU). The EC50 is 1.880-2.195 ng/mL. Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human TNFRSF10B at 2 μg/mL can bind Anti-TNFRSF10B recombinant antibody (CSB-RA023965MA2HU). The EC50 is 1.880-2.195 ng/mL.
Target Names
Uniprot No.
Alternative Names
Tumor necrosis factor receptor superfamily member 10B; Death receptor 5; TNF-related apoptosis-inducing ligand receptor 2 (TRAIL receptor 2; TRAIL-R2); CD262; TNFRSF10B; DR5, KILLER, TRAILR2, TRICK2, ZTNFR9; UNQ160/PRO186
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
56-182aa
Target Protein Sequence
ITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKE
Mol. Weight
15.7 kDa
Protein Length
Partial
Tag Info
C-terminal 10xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Death receptor 5 mediates TRAIL-induced apoptosis in tumor cells, making it a critical target for cancer immunotherapy and antibody-based therapeutic development. This mammalian-expressed construct spanning residues 56–182 captures the extracellular ligand-binding domain with native post-translational modifications that preserve conformational epitopes essential for antibody recognition. Functional ELISA validation demonstrates specific antibody binding with an EC50 of 1.880–2.195 ng/mL, confirming the protein's suitability for therapeutic antibody epitope mapping, competitive inhibition screening, and blocking antibody validation in oncology drug discovery programs. The combination of >95% purity and <1.0 EU/μg endotoxin meets the quality thresholds commonly required for ligand-binding assays, surface plasmon resonance affinity characterization, and bio-layer interferometry studies aimed at profiling TRAIL-R2 interactions with agonistic or antagonistic biologics.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for the cytotoxic ligand TNFSF10/TRAIL. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. Promotes the activation of NF-kappa-B. Essential for ER stress-induced apoptosis.
Gene References into Functions
  1. in vivo data confirmed that anti-tumor activity of bigelovin in Colorectal cancer (CRC)was through induction of apoptosis by up-regulating DR5 and increasing ROS. In conclusion, these results strongly suggested that bigelovin has potential to be developed as therapeutic agent for CRC patients PMID: 28181527
  2. GDF-15 and TRAIL-R2 were the most powerful Proximity Extension Assay chip biomarkers in predicting long-term all-cause mortality in patients with acute myocardial infarction. PMID: 28762762
  3. In contrast to apoptosis, necroptotic signaling was activated similarly by both DR4- or DR5-specific ligands..Our study provides the first systematic insight into DR4-/DR5-specific signaling in colorectal and pancreatic cancer cells PMID: 29278689
  4. These data suggest that the humanized anti-TRAIL-R2 monoclonal antibody or the second generation of the antibody may have an important clinical usage for cancer immunotherapy PMID: 28748573
  5. We found that pharmacological application of Golgi stress leads to induction of death receptors (DRs) 4 and 5. DR4 appears to be primarily responsible for the initiation of cell death downstream of Golgi stress, whereas DR5 seems to be more important for cell death triggered by endoplasmic reticulum (ER) stress in specific cancer cell lines PMID: 28981087
  6. Knocking-down of TRAIL-DR5 gene in breast cancer cells MCF-7 markedly decreased the mRNA and protein levels of the autophagy-related factors. PMID: 29268854
  7. Antineoplasic agents etoposide (ET) and doxorubicin enhance the expression of Death receptor 5 (DR5) in triple-negative breast cancer (TNBC) cells. DR5 residue SerB68 is important in mediating the receptor-drug interaction. Apoptosis and DR5 expression are induced in xenograft mice and in TNBC patient-derived metastatic cells after treatment with TNF-Related Apoptosis-Inducing Ligand (TRAIL) and ET. PMID: 28702823
  8. DR5, BIRC5/Survivin, XIAP, c-IAP1 and c-IAP2 mRNA expression are significantly deregulated in CRC and could provide a panel of markers with significant discriminatory value between CRC and normal colorectal tissue PMID: 27827395
  9. The B-Raf inhibitor PLX4032 induces DR5 upregulation exclusively in Ras-mutant cancer cells; this effect is dependent on Ras/c-Raf/MEK/ERK signaling activation. PMID: 27222248
  10. EPHB6 induces marked fragmentation of the mitochondrial network in breast cancer cells of triple-negative origin. This response renders cancer cells more susceptible to DR5-mediated apoptosis. PMID: 27788485
  11. Both S1P and caspase-8 are critical for TRAF2 stabilization, polyubiquitination, subsequent activation of JNK/AP1 signaling and MMP1 expression and final promotion of cell invasion. PMID: 28482915
  12. DNA fragmentation, mitochondrial membrane potential and western blot analyses showed that MIC inhibited the growth of these cells by both mitochondrialmediated and death receptor (DR5)mediated apoptosis pathways PMID: 28498480
  13. targeting of lysosomes by chloroquine deregulates DR5 trafficking and abrogates 5-FU- but not TRAIL-stimulated cell elimination, hence suggesting a novel mechanism for receptor activation PMID: 27506940
  14. siRNA silencing of CHOP significantly reduced cyproterone acetate-induced DR5 up-regulation and TRAIL sensitivity in prostate cancer cells. Our study shows a novel effect of cyproterone acetate on apoptosis pathways in prostate cancer cells and raises the possibility that a combination of TRAIL with cyproterone acetate could be a promising strategy for treating castration-resistant prostate cancer PMID: 28270124
  15. PU.1 supports TRAIL-induced cell death by inhibiting RelA-mediated cell survival and inducing DR5 expression. PMID: 28362429
  16. The results demonstrated CaM binding to DR5-mediated DISC in a calcium dependent manner and may identify CaM as a key regulator of DR5-mediated DISC formation for apoptosis in breast cancer. PMID: 28092099
  17. The oncogene-like extracellular miR-1246 could act as a signaling messenger between irradiated and non-irradiated lung cancer cells, more importantly, it contributes to cell radioresistance by directly suppressing the DR5 gene. PMID: 27129166
  18. Data show that 4EGI-1 compound induced apoptosis in nasopharyngeal carcinoma cells through the death receptor 5 (DR5) on 4E-BP1 dephosphorylation exerting positive influence on their anti-tumor activities. PMID: 26942880
  19. Results show that downregulation of DR4 and DR5 by SLC26A2 confers resistance to TRAIL. PMID: 28108622
  20. Study provides direct biophysical evidence that Death Receptor 5 disulfide-linked transmembrane (TM)-dimers open in response to ligand binding. Then, to probe the importance of the closed-to-open TM domain transition in the overall energetics of receptor activation, point-mutants (alanine to phenylalanine) in the predicted, tightly packed TM domain dimer interface were designed and tested. PMID: 28746849
  21. Oridonin analog CYD-6-28 induces apoptosis at least partially by inducing the expression of death receptor 5 in breast neoplasms. PMID: 27387452
  22. The authors show that cholesterol is necessary for the covalent dimerization of DR5 transmembrane domains. PMID: 27720987
  23. Mono treatment with lexatumumab was not sufficient to induce apoptosis in pancreatic cancer cells, whereas focal adhesion kinase inhibitor PF573228 significantly sensitized lexatumumab-induced apoptosis. Western blotting analysis revealed that lexatumumab and PF573228 combination treatment increased death receptor 5 but decreased Bcl-xL expression. PMID: 28459212
  24. MG132 possesses anti-gallbladder cancer potential that correlate with regulation of DR5-dependent pathway. PMID: 27277541
  25. CAPE/TRAIL stimulated apoptosis through the binding of TRAIL to DR5. Moreover, expression of transcription factor C/EBP homologous protein (CHOP) markedly increased in response to CAPE and transient knockdown of CHOP abolished CAPE/TRAIL-mediated apoptosis. PMID: 27260301
  26. Decreased level of placental TRAIl-R2 and previous C-section were found to be significantly correlated to placenta accreta. PMID: 26992667
  27. Results show that calmodulin (CaM) directly binds to death receptor-5 (DR5) in a calcium dependent manner in breast cancer cells. PMID: 27129269
  28. Bee venom inhibits colon cancer cell growth, and these anti-proliferative effects may be related to the induction of apoptosis by activation of DR4 and DR5 and inhibition of NF-kappaB activity. PMID: 26561202
  29. study involving a relatively large sample size showed that TNFRSF10 eQTL SNPs within lncRNAs might influence both hepatocellular carcinoma development and HBV infection PMID: 26297860
  30. Data show that when death receptor 5 (DR5) is suppressed, caspase-8 may recruit and stabilize TNF receptor-associated factor 2 (TRAF2) to form a metastasis and invasion signaling complex, resulting in activation of ERK signaling. PMID: 26510914
  31. Synthetic lipid bilayers displaying the membrane protein ligand Apo2L/TRAIL were used to stimulate death receptor-expressing cells in a modular, scalable format PMID: 26458551
  32. Methionine Deprivation Induces a Targetable Vulnerability in Triple-Negative Breast Cancer Cells by Enhancing TRAIL Receptor-2 Expression PMID: 25724522
  33. Studied an array of TRAIL-R1 and TRAIL-R2 specific variants on pancreatic cancer cells. PMID: 26138346
  34. The expression of two proapoptotic genes, FAS and DR5, was significantly lower in tumor samples than in adjacent normal tissues PMID: 25795228
  35. In an osteotropic variant of MDA-MB-231 breast cancer cells, TRAIL-R2 knockdown leads to downregulation of HMGA2, p-Src, p-Akt and CXCR4 and increased E-cadherin expression. These changes diminished occurrence of skeletal metastases in vivo. PMID: 25909161
  36. mutant genotype (CT+TT) of DR5 (rs1047266) may exert a negative synergistic effect on crohn disease. PMID: 26418999
  37. Studied the apoptosis of hepatic stellate cells induced by SEA; found it could be reduced in hepatic stellate cells that were treated with p53-specific siRNA and in hepatic stellate cells that were treated with DR5-specific shRNA. PMID: 25144704
  38. Taken together, our results strongly suggest that FLLL12 induces apoptosis of lung cancer cell lines by posttranscriptional regulation of DR5 through activation of protein tyrosine phosphatase(s). PMID: 25917567
  39. findings highlight novel mechanisms underlying endoplasmic reticulum stress-induced TNFRSF10A and TNFRSF10B expressions and apoptosis. PMID: 25770212
  40. DR5 expression is dramatically reduced as a function of higher prostate tumor grade. PMID: 25174820
  41. was statistically significant association between DR5 expression and tumor site of asal cell and squamous cell carcinoma skin cancers PMID: 24212133
  42. Data suggest that H-Ras inhibits TNF-related apoptosis-inducing ligand (TRAIL)-induced apoptosis through downregulation of surface death receptors DR4/DR5. PMID: 25026275
  43. Over-expression of TRAIL-R2 is associated with breast cancer. PMID: 25230899
  44. The results show that both TRAIL-R1 and TRAIL-R2 are highly expressed on human oligodendrocyte progenitors. PMID: 25845236
  45. Further analysis demonstrated that PARP inhibitor treatment results in activation of the FAS and TNFRSF10B (death receptor 5 (DR5)) promoters, increased Fas and DR5 mRNA, and elevated cell surface expression of these receptors in sensitized cells PMID: 24895135
  46. This study demonstrated lower apoptosis correlated with a deficiency of DR5 cell surface expression by CD4 T cells upon HIV-1 stimulation. PMID: 25110157
  47. Report RR5 up-regulation in alveolar epithelial cells from idiopathic pulmonary fibrosis patients. PMID: 24551275
  48. Primary EOC is associated with lower TRAIL-R2 and BCL2 expression levels, while metastatic EOC is associated with higher expression of these genes. PMID: 24190693
  49. Parthenolide triggers extrinsic apoptosis by up-regulating TNFRSF10B and intrinsic apoptosis through increasing the expression of PMAIP1. PMID: 24387758
  50. Cotreatment with MESC and an ERK inhibitor (PD98059) significantly increased the expression of DR5 to induce apoptosis...MESC may induce apoptosis via the ERK pathway and may be a potential anticancer drug candidate against human oral MEC. PMID: 24270523

Show More

Hide All

Involvement in disease
Squamous cell carcinoma of the head and neck (HNSCC)
Subcellular Location
Membrane; Single-pass type I membrane protein.
Tissue Specificity
Widely expressed in adult and fetal tissues; very highly expressed in tumor cell lines such as HeLaS3, K-562, HL-60, SW480, A-549 and G-361; highly expressed in heart, peripheral blood lymphocytes, liver, pancreas, spleen, thymus, prostate, ovary, uterus,
Database Links

HGNC: 11905

OMIM: 275355

KEGG: hsa:8795

STRING: 9606.ENSP00000276431

UniGene: Hs.521456

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*