Recombinant Human Tumor necrosis factor receptor superfamily member 10B(TNFRSF10B),partial

In Stock
Code CSB-AP004921HU
Product Type Tumor Necrosis Factor
Size US$65Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. O14763
Lead Time 5-10 business days
Storage Buffer Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4
Alias Tumor Necrosis Factor Receptor Superfamily Member 10B; Death Receptor 5; TNF-Related Apoptosis-Inducing Ligand Receptor 2; TRAIL Receptor 2; TRAIL-R2; CD262; TNFRSF10B; DR5; KILLER; TRAILR2; TRICK2; ZTNFR9
Species Homo sapiens (Human)
Biological_Activity The ED50 as determined by its ability to inhibit TRAIL-mediated cytotoxicity using L?929 mouse fibroblast cells treated with TRAIL is typically 23 ng/mL.
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence ITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKE
Research Area Cancer
Source Mammalian cell
Gene Names TNFRSF10B
Expression Region 56-182aa
Tag Info C-terminal 6xHis-FC-tagged
Mol. Weight 42.2 kDa
Protein Description Partial
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for the cytotoxic ligand TNFSF10/TRAIL
Involvement in disease Squamous cell carcinoma of the head and neck (HNSCC)
Subcellular Location Membrane, Single-pass type I membrane protein
Tissue Specificity Widely expressed in adult and fetal tissues; very highly expressed in tumor cell lines such as HeLaS3, K-562, HL-60, SW480, A-549 and G-361; highly expressed in heart, peripheral blood lymphocytes, liver, pancreas, spleen, thymus, prostate, ovary, uterus,
Database Links

HGNC: 11905

OMIM: 275355

KEGG: hsa:8795

STRING: 9606.ENSP00000276431

UniGene: Hs.521456

Pathway p53 signaling pathway
Apoptosis
Necroptosis
Natural killer cell mediated cytotoxicity

Related Products

TNFRSF10B Antibodies

TNFRSF10B Antibodies for Homo sapiens (Human)

TNFRSF10B Antibodies for Human

TNFRSF10B Proteins

TNFRSF10B Proteins for Homo sapiens (Human)

TNFRSF10B ELISA Kit

TNFRSF10B ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.