Recombinant Human Tumor necrosis factor receptor superfamily member 11A (TNFRSF11A), partial

Code CSB-MP896933HU
MSDS
Size $268
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
TNFRSF11A
Uniprot No.
Research Area
Immunology
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
30-212aa
Target Protein Sequence
IAPPCTSEKHYEHLGRCCNKCEPGKYMSSKCTTTSDSVCLPCGPDEYLDSWNEEDKCLLHKVCDTGKALVAVVAGNSTTPRRCACTAGYHWSQDCECCRRNTECAPGLGAQHPLQLNKDTVCKPCLAGYFSDAFSSTDKCRPWTNCTFLGKRVEHHGTEKSDAVCSSSLPARKPPNEPHVYLP
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
50.0 kDa
Protein Length
Partial
Tag Info
C-terminal hFc-Flag-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for TNFSF11/RANKL/TRANCE/OPGL; essential for RANKL-mediated osteoclastogenesis. Involved in the regulation of interactions between T-cells and dendritic cells.
Gene References into Functions
  1. Reduced miR-144-3p expression in serum and bone mediates osteoporosis pathogenesis by targeting RANK. PMID: 29334613
  2. findings indicate that C/EBPalpha is a stronger inducer of osteoclast differentiation than c-Fos, partly via C/EBPalpha regulation by the RANK (535)IVVY(538) motif PMID: 29122885
  3. gammadelta T cells suppressed iDCs osteoclastogenesis by downregulation of the RANK/cFos/ATP6V0D2 signaling pathway. PMID: 30066839
  4. RANK protein expression increased from normal to malignant endometrium, and the expression level was related with tumor grade but not with stage or the age of subjects in endometrial cancer. PMID: 29932437
  5. study identified the second disease gene for DOS. TNFRSF11A isoforms may have the different roles in skeletal development and metabolism PMID: 29568001
  6. The mRNA expression of RANK was highest in prostate tumour tissue from patients with bone metastases as compared to BPH or locally confined tumours, also shown in clinical subgroups distinguished by Gleason Score or PSA level. PMID: 29204705
  7. RANK 575C>T polymorphisms did not show any statistically significant differences between the study groups (Osteoporosis and Osteopenia) and Postmenopausal women. PMID: 27304650
  8. For the RANK gene, the AGTGC haplotype was associated with the lowest risk of presenting chronic joint pain in individuals without TMD (P=0.03). This study supports the hypothesis that changes in the OPG and RANK genes influence the presence of chronic joint pain in individuals with and without TMD. PMID: 28464982
  9. In this study, whole exome sequencing (WES) was successfully used in six patients with malignant infantile osteopetrosis (MIOP) and identified mutations in four MIOP-related genes (CLCN7, TCIRG1, SNX10, and TNFRSF11A). PMID: 27187610
  10. RANK is increased in hormone receptor negative and basal breast cancer, and correlates with worse recurrence-free survival and risk of bone metastasis. PMID: 28577080
  11. RANK SNP rs34945627 has a high allelic frequency in patients with breast cancer and Bone metastases, and is associated with decreased disease-free survival and Overall Survival. PMID: 27191503
  12. RANK rewires energy homeostasis in human lung cancer cells and promotes expansion of lung cancer stem-like cells. PMID: 29118048
  13. EGFR and RANK combinatorial in vitro analyses revealed a significant upregulation of AKT and ERK signaling after EGF stimulation in cell lines and also an increase of breast cancer cell invasiveness. PMID: 29025596
  14. In histologically normal tissue of BRCA1-mutation carriers and showed that RANK(+) cells are highly proliferative, have grossly aberrant DNA repair and bear a molecular signature similar to that of basal-like breast cancer. PMID: 27322743
  15. Vav3 is a novel TRAF6 interaction partner that functions in the activation of cooperative signaling between T6BSs and the IVVY motif in the RANK signaling complex. PMID: 27507811
  16. RANK and CCR6 expressed on monocytes may be novel targets for the regulation of bone resorption in rheumatoid arthritis and osteoporosis. PMID: 27822475
  17. High RANK expression is associated with endometrial metastasis. PMID: 26734994
  18. Study showed that endogenous RANK expression changes might influence prostate cancer cell behavior since reduced RANK expression resulted in significantly increased PC-3 cell proliferation and adhesion. PMID: 26977008
  19. genetic variation associated with hypertension in Chinese women PMID: 25810067
  20. we could not identify any association between external apical root resorption and two SNPs, rs1805034 from TNFRSF11A (encoding RANK) and rs3102735 from TNFRSF11B (encoding OPG). PMID: 24118270
  21. Results suggest that Cbl-b improves the prognosis of RANK-expressing breast cancer patients by inhibiting RANKL-induced breast cancer cell migration and metastasis. PMID: 26087197
  22. Based on our findings, the functional SNP RANK rs1805034 T>C may be an indicator for individual susceptibility to GCA. PMID: 26451891
  23. Functional polymorphisms RANK rs1805034 T>C may be an indicator for individual susceptibility to esophageal squamous cell carcinoma. PMID: 25019155
  24. These findings indicate that epidermal leukocytes gradually acquire RANK during gestation - a phenomenon previously observed also for other markers on LCs in prenatal human skin. PMID: 25722033
  25. this study is the first to identify RANK overexpression as a novel esophageal cancer marker in both Kazakh and Han ethnic esophageal squamous cell carcinoma patients. PMID: 25973136
  26. RANK/OPG ratio of expression in primary ccRCC is associated with BM. PMID: 26528707
  27. Three single nucleotide polymorphisms of TNFRSF11A (rs4500848, rs6567270 and rs1805034) are associated with Age at menarche and Age at natural menopause in Chinese women. PMID: 25884698
  28. Microcomputed tomography analysis demonstrated that the mice treated with rhRANK exhibited an increased bone volume and structure model index, and decreased trabecular spacing compared with those treated with rhOPG-Fc. PMID: 25738879
  29. results indicate that the RANK IVVY motif cooperates with the TRAF-binding motifs to promote osteoclastogenesis, which provides novel insights into the molecular mechanism of RANK signaling in osteoclastogenesis. PMID: 26276390
  30. Response to sRANKL in normal and tumor cells suggests a role for RANK/ERK-mediated signaling in normal osteoblasts chemotactic migration during bone remodeling that is altered or lost during osteosarcoma tumorigenesis. PMID: 25893522
  31. Higher RANK expression in the primary breast tumor is associated with a higher sensitivity to chemotherapy, but also a higher risk of relapse and death. PMID: 24737168
  32. Changes in bone markers, OPG, sRANKL and/or the OPG/sRANKL ratio exhibited by girls with Anorexia nervosa have been found to be associated with changes in the levels of the selected adipose tissue hormones. PMID: 24549600
  33. Genetic polymorphism in TNFRSF11A influences bone mineral density in post-menopausal women. PMID: 25138264
  34. Single nucleotide polymorphisms of RANK and PTGS1 show genetic associations with osteoproliferative changes in ankylosing spondylitis. PMID: 24651623
  35. he top hit rs17069906 (p = 5.6 e-10) is located within the genomic region of RANK, recently demonstrated to be an important player in the adaptive recovery response in podocytes and suggested as a promising therapeutic target in glomerular diseases. PMID: 25478860
  36. This review study has focused on the association of RANKL-RANK-OPG pathway in the pathogenesis and progression of giant cell tumor of bone as well as discussed the possible therapeutic strategies by targeting this pathway PMID: 25618600
  37. The urinary mRNA of RANK might be used to differentiate histologic subtypes of glomerulonephritis, particularly between minimal change disease and membranous nephropathy. PMID: 25171769
  38. RANKL and IL-6 mediate direct paracrine-autocrine signaling between cells of the osteoblast lineage and cancer cells. PMID: 24676805
  39. PGRN and PIRO form a new regulatory axis in osteoclastogenesis that is included in RANK signaling in cell fusion and OC resorption of osteoclastogenesis PMID: 25406312
  40. we identified RANK expression as a negative prognostic factor regarding disease-free survival in osteosarcoma PMID: 24842377
  41. High RANK protein expression is associated with breast cancer. PMID: 25111682
  42. RANKL, either derived from the prostate tumor or from the host, plays a key role in cancer bone metastasis. PMID: 24478054
  43. The involvement of TNFRSF11A in hereditary recurrent fever highlights the key role of this receptor in innate immunity. PMID: 24891336
  44. Mechanistic studies showed that IL-10 downregulated RANK expression in monocytes and thus, inhibited RANKL-induced OC formation PMID: 24340030
  45. silencing of miR-503 using a specific antagomir in ovariectomy (OVX) mice increased RANK protein expression, promoted bone resorption PMID: 23821519
  46. The genotypes, combined genotypes and allele frequencies of C421T and C575T polymorphisms of the RANK gene have not been found to be associated with bone mineral density in Turkish women. PMID: 23553199
  47. RANK signaling interferes with mammary cell commitment, contributing to breast carcinogenesis. PMID: 23766243
  48. High RANK expression is associated with Avascular Necrosis of Femur Head. PMID: 24200492
  49. The atrial expression of RANK (and RANKL/osteoprotegerin ratio) was higher in normal controls compared to persistent atrial fibrillation patients. PMID: 22178057
  50. One mechanism of RANK inhibition by 1,25(OH)2D3 is down-regulation of the M-CSF receptor c-Fms, which is required for the expression of RANK. PMID: 23116709

Show More

Hide All

Involvement in disease
Familial expansile osteolysis (FEO); Paget disease of bone 2, early-onset (PDB2); Osteopetrosis, autosomal recessive 7 (OPTB7)
Subcellular Location
[Isoform 1]: Cell membrane; Single-pass type I membrane protein.; [Isoform RANK-e5a]: Cell membrane; Single-pass type I membrane protein.
Tissue Specificity
Ubiquitous expression with high levels in skeletal muscle, thymus, liver, colon, small intestine and adrenal gland.
Database Links

HGNC: 11908

OMIM: 174810

KEGG: hsa:8792

STRING: 9606.ENSP00000465500

UniGene: Hs.204044

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*