Recombinant Human Tumor necrosis factor receptor superfamily member 11A(TNFRSF11A),partial

In Stock
Code CSB-RP084674h
Product Type Recombinant Protein
Size US$1726Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. Q9Y6Q6
Lead Time 3-7 business days
Relevance Receptor for TNFSF11/RANKL/TRANCE/OPGL; essential for RANKL-mediated osteoclastogenesis. Involved in the regulation of interactions between T-cells and dendritic cells.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Osteoclast differentiation factor receptor ;ODFRReceptor activator of NF-KB; CD265
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence LQIAPPCTSEKHYEHLGRCCNKCEPGKYMSSKCTTTSDSVCLPCGPDEYLDSWNEEDKCLLHKVCDTGKALVAVVAGNSTTPRRCACTAGYHWSQDCECCRRNTECAPGLGAQHPLQLNKDTVCKPCLAGYFSDAFSSTDKCRPWTNCTFLGKRVEHHGTEKSDAVCSSSLPARK
Research Area Immunology
Source E.coli
Gene Names TNFRSF11A
Expression Region 28-202aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 23.2kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for TNFSF11/RANKL/TRANCE/OPGL; essential for RANKL-mediated osteoclastogenesis. Involved in the regulation of interactions between T-cells and dendritic cells.
Involvement in disease Familial expansile osteolysis (FEO); Paget disease of bone 2, early-onset (PDB2); Osteopetrosis, autosomal recessive 7 (OPTB7)
Subcellular Location Isoform 1: Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform RANK-e5a: Cell membrane, Single-pass type I membrane protein
Tissue Specificity Ubiquitous expression with high levels in skeletal muscle, thymus, liver, colon, small intestine and adrenal gland.
Database Links

HGNC: 11908

OMIM: 174810

KEGG: hsa:8792

STRING: 9606.ENSP00000465500

UniGene: Hs.204044

Pathway NF-kappa B signaling pathway
Osteoclast differentiation

Related Products

TNFRSF11A Antibodies

TNFRSF11A Antibodies for Human

TNFRSF11A Antibodies for Homo sapiens (Human)

TNFRSF11A Proteins

TNFRSF11A Proteins for Homo sapiens (Human)

TNFRSF11A ELISA Kit

TNFRSF11A ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.