Name: Recombinant Mouse CD63 antigen(Cd63) ,partial
Brand: CUSABIO
SKU: CSB-EP004950MO

Product Details

Purity	Greater than 85% as determined by SDS-PAGE.
Target Names	Cd63
Uniprot No.	P41731
Research Area	Others
Alternative Names	Cd63CD63 antigen; CD antigen CD63
Species	Mus musculus (Mouse)
Source	E.coli
Expression Region	103-203aa
Target Protein Sequence	AGYVFRDQVKSEFNKSFQQQMQNYLKDNKTATILDKLQKENNCCGASNYTDWENIPGMAKDRVPDSCCINITVGCGNDFKESTIHTQGCVETIAIWLRKNI Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight	15.5
Protein Length	Extracellular Domain
Tag Info	N-terminal 6xHis-tagged
Form	Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs	Protein FAQs
Storage Condition	Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time	Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA	Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Earn $30 Amazon Card or 20μL/μg CUSABIO Trial Size Antibody. Details of rewards >>

Target Data

Function	Functions as cell surface receptor for TIMP1 and plays a role in the activation of cellular signaling cascades. Plays a role in the activation of ITGB1 and integrin signaling, leading to the activation of AKT, FAK/PTK2 and MAP kinases. Promotes cell survival, reorganization of the actin cytoskeleton, cell adhesion, spreading and migration, via its role in the activation of AKT and FAK/PTK2. Plays a role in VEGFA signaling via its role in regulating the internalization of KDR/VEGFR2. Plays a role in intracellular vesicular transport processes, and is required for normal trafficking of the PMEL luminal domain that is essential for the development and maturation of melanocytes. Plays a role in the adhesion of leukocytes onto endothelial cells via its role in the regulation of SELP trafficking. May play a role in mast cell degranulation in response to Ms4a2/FceRI stimulation, but not in mast cell degranulation in response to other stimuli.
Gene References into Functions	In renal proximal tubules, CD63 determines the insertion of OCT2 into the proper membrane domain and mediates transporter regulation by trafficking processes. PMID: 28031320 TIMP1 signaling via CD63 leads to activation of hepatic stellate cells, which create an environment in the liver that increases its susceptibility to pancreatic tumor cells. PMID: 27506299 The Muted protein is important for the steady-state level of CD63. PMID: 27531610 Data show that CD63 is a crucial player in the regulation of the tumor cell-intrinsic metastatic potential by affecting cell plasticity. PMID: 25354204 These findings identify CD63 as an important component of allergic inflammation. PMID: 23945142 CD63 serves to bridge between beta1 integrin and VEGFR2 because CD63 silencing disrupted VEGFR2-beta1 integrin complex formation identified using proximity ligation assay PMID: 23632027 Loss of CD63 is associated impairment of amyloidogenesis and downstream melanosome morphogenesis. PMID: 21962903 Loss of CD63 has a similar phenotype to loss of P-selectin itself, thus CD63 is an essential cofactor to P-selectin. PMID: 21803846 CXCR4 can be downregulated on activated B cells by IL-21-induced endocytosis and CD63-mediated endosomal recruitment. PMID: 21270405 The findings identify palmitoylation-dependent association with the tetraspanin CD63 as the mechanism by which Syt VII is targeted to lysosomes. PMID: 21041449 CD63, but not RILP, is recruited to the phagosomes in macrophages expressing the dominant negative form of Rab7. PMID: 20236428 CD63 is recruited to already-budded Weibel-Palade bodies by an AP-3-dependent route PMID: 16683915 Upon phagocytosis of Cryptococcus neoformans and polystyrene beads, CD63 was recruited selectively to C. neoformans-containing phagosomes in a MyD88-independent acidification-dependent manner PMID: 17043215 protein region defined by amino acid residues 103-205 for CD63 interacts with amelogenin PMID: 17708745 CD63 knockout mice show an increased urinary flow, water intake, reduced urine osmolality, and a higher fecal water content. PMID: 19075008 the activation-induced degranulation of Fas ligand has distinct requirements and involves different mechanisms than those of the granule markers CD63 and CD107a/Lamp-1 PMID: 19079288 Show More Hide All
Subcellular Location	Cell membrane, Multi-pass membrane protein, Lysosome membrane, Multi-pass membrane protein, Late endosome membrane, Multi-pass membrane protein, Endosome, multivesicular body, Melanosome, Secreted, exosome, Cell surface
Protein Families	Tetraspanin (TM4SF) family
Tissue Specificity	Ubiquitous. Strongly expressed in kidney. Detected in spleen, bone marrow, peripheral blood mononuclear cells and macrophages.
Database Links	KEGG: mmu:12512 STRING: 10090.ENSMUSP00000026407 UniGene: Mm.371552

CloseMessage

Product >> Product Name：
Product >> Code：
Product >> Size：
Name： *
Email： *
Phone：
We recommend you to leave your phone number because occasionally our emails get flagged by spam filters. We would not disclose any of your private information to any third party.
Question/Comment： *
Your Region： *
Country State：
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
Check Code：

Recombinant Mouse CD63 antigen(Cd63) ,partial

Product Details

Related Products

Customer Reviews and Q&A

Target Data

CloseMessage

×CloseMessage

Code	CSB-EP004950MO
Size	US$2466
Have Questions?	Leave a Message or Start an on-line Chat