Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

Cd63

Uniprot No.

P41731

Research Area

Others

Alternative Names

Cd63CD63 antigen; CD antigen CD63

Species

Mus musculus (Mouse)

Source

E.coli

Expression Region

103-203aa

Target Protein Sequence

AGYVFRDQVKSEFNKSFQQQMQNYLKDNKTATILDKLQKENNCCGASNYTDWENIPGMAKDRVPDSCCINITVGCGNDFKESTIHTQGCVETIAIWLRKNI
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

38.5kDa

Protein Length

Extracellular Domain

Tag Info

N-terminal GST-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Amino acids 103-203 form the expressed segment for recombinant Mouse Cd63. The expected molecular weight for the Cd63 protein is calculated to be 38.5 kDa. This Cd63 protein is produced using e.coli expression system. The N-terminal GST tag was fused into the coding gene segment of Cd63, making it easier to detect and purify the Cd63 recombinant protein in the later stages of expression and purification.

The CD63 antigen is a crucial membrane protein involved primarily in intracellular and extracellular substance transport and signal transduction. Its research spans multiple fields, including immunology, oncology, and cell biology. In immunology, CD63 plays a pivotal role in the antigen presentation process, especially when antigens are delivered to the cell surface and participate in immune responses. Scientists focus on unraveling the molecular mechanisms through which CD63 regulates immune reactions, enhancing our understanding of immune system functions. In oncology, CD63 has been found to be closely associated with the invasion and migration of tumor cells. Its expression and regulation in the tumor microenvironment significantly impact the occurrence and development of tumors. Additionally, CD63 participates in intercellular substance exchange, such as the generation and release of exosomes.

Target Background

Function

Functions as cell surface receptor for TIMP1 and plays a role in the activation of cellular signaling cascades. Plays a role in the activation of ITGB1 and integrin signaling, leading to the activation of AKT, FAK/PTK2 and MAP kinases. Promotes cell survival, reorganization of the actin cytoskeleton, cell adhesion, spreading and migration, via its role in the activation of AKT and FAK/PTK2. Plays a role in VEGFA signaling via its role in regulating the internalization of KDR/VEGFR2. Plays a role in intracellular vesicular transport processes, and is required for normal trafficking of the PMEL luminal domain that is essential for the development and maturation of melanocytes. Plays a role in the adhesion of leukocytes onto endothelial cells via its role in the regulation of SELP trafficking. May play a role in mast cell degranulation in response to Ms4a2/FceRI stimulation, but not in mast cell degranulation in response to other stimuli.

Gene References into Functions

In renal proximal tubules, CD63 determines the insertion of OCT2 into the proper membrane domain and mediates transporter regulation by trafficking processes. PMID: 28031320
TIMP1 signaling via CD63 leads to activation of hepatic stellate cells, which create an environment in the liver that increases its susceptibility to pancreatic tumor cells. PMID: 27506299
The Muted protein is important for the steady-state level of CD63. PMID: 27531610
Data show that CD63 is a crucial player in the regulation of the tumor cell-intrinsic metastatic potential by affecting cell plasticity. PMID: 25354204
These findings identify CD63 as an important component of allergic inflammation. PMID: 23945142
CD63 serves to bridge between beta1 integrin and VEGFR2 because CD63 silencing disrupted VEGFR2-beta1 integrin complex formation identified using proximity ligation assay PMID: 23632027
Loss of CD63 is associated impairment of amyloidogenesis and downstream melanosome morphogenesis. PMID: 21962903
Loss of CD63 has a similar phenotype to loss of P-selectin itself, thus CD63 is an essential cofactor to P-selectin. PMID: 21803846
CXCR4 can be downregulated on activated B cells by IL-21-induced endocytosis and CD63-mediated endosomal recruitment. PMID: 21270405
The findings identify palmitoylation-dependent association with the tetraspanin CD63 as the mechanism by which Syt VII is targeted to lysosomes. PMID: 21041449
CD63, but not RILP, is recruited to the phagosomes in macrophages expressing the dominant negative form of Rab7. PMID: 20236428
CD63 is recruited to already-budded Weibel-Palade bodies by an AP-3-dependent route PMID: 16683915
Upon phagocytosis of Cryptococcus neoformans and polystyrene beads, CD63 was recruited selectively to C. neoformans-containing phagosomes in a MyD88-independent acidification-dependent manner PMID: 17043215
protein region defined by amino acid residues 103-205 for CD63 interacts with amelogenin PMID: 17708745
CD63 knockout mice show an increased urinary flow, water intake, reduced urine osmolality, and a higher fecal water content. PMID: 19075008
the activation-induced degranulation of Fas ligand has distinct requirements and involves different mechanisms than those of the granule markers CD63 and CD107a/Lamp-1 PMID: 19079288

Hide All

Subcellular Location

Cell membrane; Multi-pass membrane protein. Lysosome membrane; Multi-pass membrane protein. Late endosome membrane; Multi-pass membrane protein. Endosome, multivesicular body. Melanosome. Secreted, extracellular exosome. Cell surface.

Protein Families

Tetraspanin (TM4SF) family

Tissue Specificity

Ubiquitous. Strongly expressed in kidney. Detected in spleen, bone marrow, peripheral blood mononuclear cells and macrophages.

Database Links

KEGG: mmu:12512

STRING: 10090.ENSMUSP00000026407

UniGene: Mm.371552

Code	CSB-EP004950MOe0
Abbreviation	Recombinant Mouse Cd63 protein, partial
MSDS	MSDS Datasheet
Size	US$306
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Mouse CD63 antigen (Cd63), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage