Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
Cd63CD63 antigen; CD antigen CD63
Species
Mus musculus (Mouse)
Expression Region
103-203aa
Target Protein Sequence
AGYVFRDQVKSEFNKSFQQQMQNYLKDNKTATILDKLQKENNCCGASNYTDWENIPGMAKDRVPDSCCINITVGCGNDFKESTIHTQGCVETIAIWLRKNI
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Extracellular Domain
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Amino acids 103-203 form the expressed segment for recombinant Mouse Cd63. The expected molecular weight for the Cd63 protein is calculated to be 38.5 kDa. This Cd63 protein is produced using e.coli expression system. The N-terminal GST tag was fused into the coding gene segment of Cd63, making it easier to detect and purify the Cd63 recombinant protein in the later stages of expression and purification.
The CD63 antigen is a crucial membrane protein involved primarily in intracellular and extracellular substance transport and signal transduction. Its research spans multiple fields, including immunology, oncology, and cell biology. In immunology, CD63 plays a pivotal role in the antigen presentation process, especially when antigens are delivered to the cell surface and participate in immune responses. Scientists focus on unraveling the molecular mechanisms through which CD63 regulates immune reactions, enhancing our understanding of immune system functions. In oncology, CD63 has been found to be closely associated with the invasion and migration of tumor cells. Its expression and regulation in the tumor microenvironment significantly impact the occurrence and development of tumors. Additionally, CD63 participates in intercellular substance exchange, such as the generation and release of exosomes.
