Home
Protein
Recombinant Proteins
Recombinant Mouse Low affinity immunoglobulin gamma Fc region receptor III (Fcgr3), partial

Recombinant Mouse Low affinity immunoglobulin gamma Fc region receptor III (Fcgr3), partial

^{In Stock}

Code	CSB-MP357412MO
Abbreviation	Recombinant Mouse Fcgr3 protein, partial
MSDS	MSDS Datasheet
Size	$440
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

Fcgr3

Uniprot No.

P08508

Research Area

Others

Alternative Names

Fcgr3Low affinity immunoglobulin gamma Fc region receptor III; IgG Fc receptor III; Fc-gamma RIII; FcRIII; CD antigen CD16

Species

Mus musculus (Mouse)

Source

Mammalian cell

Expression Region

31-215aa

Target Protein Sequence

ALPKAVVKLDPPWIQVLKEDMVTLMCEGTHNPGNSSTQWFHNGRSIRSQVQASYTFKATVNDSGEYRCQMEQTRLSDPVDLGVISDWLLLQTPQRVFLEGETITLRCHSWRNKLLNRISFFHNEKSVRYHHYKSNFSIPKANHSHSGDYYCKGSLGSTQHQSKPVTITVQDPATTSSISLVWYHT
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

25.2kDa

Protein Length

Extracellular Domain

Tag Info

N-terminal 6xHis-Myc-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

To express the recombinant Mouse Fcgr3 protein in mammalian cells, a DNA fragment encoding the Mouse Fcgr3 protein (31-215aa) is inserted into a plasmid vector and transferred to the mammalian cells. Cells containing the plasmid are screened, cultured, and induced to express the Fcgr3 protein. The protein carries a N-terminal 6xHis-Myc tag. Lysing the cells allows for the collection of the recombinant Mouse Fcgr3 protein, which is purified through affinity purification and then identified through SDS-PAGE and subsequent staining of the gel with Coomassie Brilliant Blue. The purity of the recombinant Mouse Fcgr3 protein obtained is greater than 90%.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function

Receptor for the Fc region of complexed immunoglobulins gamma. Low affinity receptor which binds to IgG1, IgG2a and IgG2b. Mediates neutrophil activation by IgG complexes redundantly with Fcgr4.

Subcellular Location

Cell membrane; Single-pass type I membrane protein.

Database Links

STRING: 10090.ENSMUSP00000131938

UniGene: Mm.22119

Promotions