Recombinant Mouse Urokinase-type plasminogen activator (Plau)

Code CSB-YP018121MO
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP018121MO
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP018121MO-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP018121MO
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥85% (SDS-PAGE)
Target Names
Uniprot No.
Alternative Names
PlauUrokinase-type plasminogen activator; U-plasminogen activator; uPA; EC 3.4.21.73) [Cleaved into: Urokinase-type plasminogen activator long chain A; Urokinase-type plasminogen activator short chain A; Urokinase-type plasminogen activator chain B]
Species
Mus musculus (Mouse)
Expression Region
21-433
Target Protein Sequence
GSVLGAPDESNCGCQNGGVCVSYKYFSRIRRCSCPRKFQGEHCEIDASKTCYHGNGDSYR GKANTDTKGRPCLAWNAPAVLQKPYNAHRPDAISLGLGKHNYCRNPDNQKRPWCYVQIGL RQFVQECMVHDCSLSKKPSSSVDQQGFQCGQKALRPRFKIVGGEFTEVENQPWFAAIYQK NKGGSPPSFKCGGSLISPCWVASAAHCFIQLPKKENYVVYLGQSKESSYNPGEMKFEVEQ LILHEYYREDSLAYHNDIALLKIRTSTGQCAQPSRSIQTICLPPRFTDAPFGSDCEITGF GKESESDYLYPKNLKMSVVKLVSHEQCMQPHYYGSEINYKMLCAADPEWKTDSCKGDSGG PLICNIEGRPTLSGIVSWGRGCAEKNKPGVYTRVSHFLDWIQSHIGEEKGLAF
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Specifically cleaves the zymogen plasminogen to form the active enzyme plasmin.
Gene References into Functions
  1. downregulation of uPA could decrease the fertility of male mice, which may be caused by a reduction in sperm motility. PMID: 28298247
  2. data presented here reveal important information about dynamics in uPA by demonstrating how various ligands can modulate uPA activity by mediating long-range conformational changes PMID: 29420634
  3. Lymphangioleiomyomatosis is fatal lung disease associated with germline/somatic inactivating mutations in TSC2 genes. Data suggest lung lymphangioleiomyomatosis lesions and renal angiomyolipomas overexpress uPA; Tsc2-/- (or Tsc1-/-) embryonic fibroblasts from knockout mice express higher uPA levels than wild-type cells. (uPA = urokinase-type plasminogen activator; Tsc = tuberous sclerosis complex protein) PMID: 28972182
  4. The findings suggest that the absence of uPA correlates with increased levels of Runx transcriptional regulators in a way that promotes inflammation-associated carcinogenesis. PMID: 29107070
  5. an intricate link between caveolin-1 and Src kinase-mediated cell signaling and alveolar epithelial cell apoptosis due to loss of SP-C expression through p53 and uPA system-mediated cross-talk, is reported. PMID: 28385810
  6. These studies identify uPA-dependent de-repression of vegfr1 and vegfr2 gene transcription through binding to HHEX/PRH as a novel mechanism by which uPA mediates the pro-angiogenic effects of VEGF and identifies a potential new target for control of pathologic angiogenesis. PMID: 27151212
  7. Significance of the urokinase-type plasminogen activator and its receptor in the progression of focal segmental glomerulosclerosis in clinical and mouse models. PMID: 26846181
  8. GM-CSF and uPA are required for Porphyromonas gingivalis-induced alveolar bone loss in a mouse periodontitis model. PMID: 25753270
  9. Plau deficiency does not worsen controlled cortical impact-induced brain pathology or epileptogenesis caused by TBI. PMID: 26253597
  10. we have firstly shown a fundamental mechanism of urokinase system(uPa and uPAR)-dependent regulation of the trajectory of growth and branching of blood vessels in early embryogenesis and in adults during the repair/regeneration of tissues. PMID: 26863767
  11. Pharmacological inhibition of either uPA or selected MMPs decreased atherosclerosis in transgenic uPA mice. PMID: 25616415
  12. Porphyromonas gingivalis-derived RgpA-Kgp complex activates the macrophage uPA. PMID: 25979345
  13. transgenic alphaMUPA mice, with genetically extended life span, showed a much slower age-related decline in the rate of wound healing than their wild-type counterparts PMID: 25960543
  14. Binding of urokinase to urokinase plasminogen activator receptor promotes dendritic spine recovery and functional outcome after ischemic stroke. PMID: 25339736
  15. our results suggest a role for uPA and uPAR in experimental autoimmune encephalomyelitis pathogenesis PMID: 24120085
  16. Urokinase plasminogen activator is a central regulator of macrophage three-dimensional invasion, matrix degradation, and adhesion. PMID: 24616477
  17. SERPINE2 and PLAU are involved in cumulus expansion and oocyte maturation. PMID: 24023701
  18. Data suggest urokinase-type plasminogen activator (uPA) is involved in susceptibility/resistance to Group A streptococcal infection (GAS); mice expressing human plasminogen transgene are more susceptible to invasive GAS than uPA knockout mice. PMID: 23853591
  19. Mice deficient in urokinase-type plasminogen activator have delayed healing of tympanic membrane perforations. PMID: 23236466
  20. PLAU is particularly important for memory Tregs and PLAU mediates Treg suppressor function via STAT5 and ERK signaling pathways. PMID: 23169000
  21. The data showed that myeloid-derived suppressor cell accumulation is tumor burden-dependent, and that tumor-derived factors such as plasminogen activator urokinase and its receptor play a role in their recruitment. PMID: 23060546
  22. The study establishes the 37- and 70-loops as a unique site for binding to compounds stabilizing the active state of serine proteases. PMID: 22950516
  23. Over-expression of uPA plays a synergistic role in the development of liver injury, inflammation and regeneration during acute HBV infection PMID: 22563169
  24. Data presented here suggest that MMP-9 is secreted as a multiprotein complex by T. gondii infected macrophages, similar to that observed in metastatic cells. PMID: 22177333
  25. u-PA and plasminogen are essential for the phagocytosis of cellular debris by macrophages during liver repair PMID: 22318286
  26. Expression of ALDH1A2, BEX2, EGR2, CCL3 and PLAU are upregulated in Toxoplasma gondiisusceptible C57BL/6 mice. PMID: 22451728
  27. suggest that uPA promotes cell migration by binding to fibulin-5, initiating its cleavage by plasmin, which leads to its dissociation from beta1-integrin and thereby unblocks the capacity of integrin to facilitate cell motility PMID: 22280367
  28. The uPA-uPAR axis has no effect on the formation of Ang II-induced abdominal aortic aneurysms, but uPA deficiency promotes aneurysmal rupture. PMID: 21868698
  29. Urokinase type plasminogen activator, at concentrations found under pathological conditions, reduced pulmonary arterial contractility and increased permeability though the activation of NMDA-R1. PMID: 21617202
  30. uPA acts in a cell signaling manner via binding to its receptor uPAR rather than as a protease. PMID: 21573723
  31. contributes to heterogeneity of macrophages at the border of damaged site during liver repair PMID: 21301782
  32. mechanisms of uPA/uPAR/plasminogen-accelerated atherosclerosis and aneurysm formation PMID: 21536666
  33. The interaction of sM6P/IGF2R with Plg may be an important regulatory mechanism to inhibit migration of cells using the uPA/uPAR system. PMID: 21273553
  34. We propose that u-PA has a protective role in arthritis models with 'wound healing-like' processes following local trauma PMID: 20973954
  35. Early experimental venous thrombus resolution is independent of uPA. PMID: 20886179
  36. study investigated whether host uPA is a crucial protagonist for the TIMP-1-induced modulation of a pro-metastatic microenvironment in the liver PMID: 19863693
  37. uPA/uPAR downregulation suppresses angiogenesis in endothelial cells induced by glioblastoma cell lines PMID: 20805979
  38. Selective abrogation of the uPA-uPAR interaction is associated with suppression of fibrin-associated inflammation. PMID: 20466854
  39. u-PA is required for the full development of systemic arthritis models involving immune complex formation and deposition. PMID: 20196869
  40. uPA plays a critical role in BV-2 microglial cell migration by activating pro-MMP-9, in part by its direct action on MMP-9 and also in part by the activation of plasminogen/plasmin cascade. PMID: 20177776
  41. uPA deficiency can unfavorably modulate both delayed neurodegeneration and neurogenesis but has little effect on post-injury neuronal migration and vascular density. Elevated uPA during the post-injury phase is neuroprotective. PMID: 20026272
  42. MAPK pathways ERK, JNK/SAPK, and P38-MAPK represent a significant component in the regulation of u-PA expression in human prostate cancer. PMID: 11676474
  43. During infection with Cryptococcus neoformans, mice genetically deficient in uPA have a decreased number of recruited effector T cells in the lung, fail to generate a protective T1 profile of cytokines, and display impaired antifungal activity. PMID: 11777975
  44. u-PA-/- mice developed significantly milder disease compared with the relevant wild-type mice PMID: 11891190
  45. fibrinolysis by uPA-dependent plasmin activity plays a fundamental role in skeletal muscle regeneration PMID: 11929773
  46. that u-PA plays important roles in liver regeneration after hepatectomy through control of a transcription factor, c-jun expression. PMID: 11983447
  47. the role of urokinase in the regulation of monocyte/macrophage functions, such as that occurring in inflammatory reactions PMID: 12183060
  48. uPA regulated by heregulin in mouse neoplasms PMID: 12209601
  49. inducible expression reduces fibrosis and mortality after lung injury in mice PMID: 12376355
  50. These results suggest that increasing uPA expression by an appropriate combination of growth factors and ECM components constitutes a possible approach to improving the migration of myogenic cells after transplantation. PMID: 12413883

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Peptidase S1 family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1