Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

NGF

Uniprot No.

Q29074

Research Area

Others

Alternative Names

NGF; NGFB; Beta-nerve growth factor; Beta-NGF; Fragment

Species

Sus scrofa (Pig)

Source

E.coli

Expression Region

110-229aa

Target Protein Sequence

SSSHPVFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAGRRA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

29.4kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-SUMO-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Amino acids 110-229 constitute the expression domain of recombinant Pig NGF. The expected molecular weight for the NGF protein is calculated to be 29.4 kDa. This NGF recombinant protein is manufactured in e.coli. Fusion of the N-terminal 6xHis-SUMO tag into the NGF encoding gene fragment was conducted, allowing for easier detection and purification of the NGF protein in subsequent stages.

Pig beta-nerve growth factor (NGF) is a neurotrophic factor crucial for neuronal survival, development, and maintenance. It promotes neurite outgrowth, regulates synaptic plasticity, and influences neurotransmitter release. In neurobiology, NGF is vital for studying neuronal differentiation and neurodegenerative diseases. Its role in pain modulation makes it relevant in analgesic research. Additionally, NGF is implicated in immune responses and tissue repair. In regenerative medicine, NGF holds potential for nerve regeneration therapies. Studying NGF provides insights into neurotrophin biology, neuroregeneration, and pain modulation, offering avenues for therapeutic interventions in neurological disorders and pain management, as well as understanding its broader implications in immune function and tissue repair.

Target Background

Function

Nerve growth factor is important for the development and maintenance of the sympathetic and sensory nervous systems. Extracellular ligand for the NTRK1 and NGFR receptors, activates cellular signaling cascades to regulate neuronal proliferation, differentiation and survival. The immature NGF precursor (proNGF) functions as ligand for the heterodimeric receptor formed by SORCS2 and NGFR, and activates cellular signaling cascades that lead to inactivation of RAC1 and/or RAC2, reorganization of the actin cytoskeleton and neuronal growth cone collapse. In contrast to mature NGF, the precursor form (proNGF) promotes neuronal apoptosis (in vitro). Inhibits metalloproteinase-dependent proteolysis of platelet glycoprotein VI. Binds lysophosphatidylinositol and lysophosphatidylserine between the two chains of the homodimer. The lipid-bound form promotes histamine relase from mast cells, contrary to the lipid-free form.

Subcellular Location

Secreted. Endosome lumen.

Protein Families

NGF-beta family

Database Links

STRING: 9823.ENSSSCP00000007197

UniGene: Ssc.19976

Code	CSB-EP643662PI
Abbreviation	Recombinant Pig NGF protein
MSDS	MSDS Datasheet
Size	US$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Pig Beta-nerve growth factor (NGF)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage