Recombinant Rat Oncostatin-M(Osm)

In Stock
Code CSB-MP723970RA
Product Type Recombinant Protein
Size US$1848
Uniprot No. Q65Z15
Abbreviation Osm
Relevance Growth regulator. Inhibits the proliferation of a number of tumor cell lines. It regulates cytokine production, including IL-6, G-CSF and GM-CSF from endothelial cells. Uses only type II OSM receptor (heterodimers composed of OSMR and IL6ST). Involved in the maturation of fetal hepatocytes, thereby promoting liver development and regeneration.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Tris-based buffer,50% glycerol
Species Rattus norvegicus (Rat)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence KRGCSSSSPKLLSQLKSQANITGNTASLLEPYILHQNLNTLTLRAACTEHPVAFPSEDMLRQLSKPDFLSTVHATLGRVWHQLGAFRQQFPKIQDFPELERARQNIQGIRNNVYCMARLLHPPLEIPEPTQADSGTSRPTTTAPGIFQIKIDSCRFLWGYHRFMGSVGRVFEEWGDGSRRSRR
Research Area Immunology
Source Mammalian cell
Gene Names Osm
Protein Names Recommended name: Oncostatin-M Short name= OSM
Expression Region 26-208aa
Tag Info N-terminal 10xHis-tagged
Mol. Weight 24.2 kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Growth regulator. Inhibits the proliferation of a number of tumor cell lines. It regulates cytokine production, including IL-6, G-CSF and GM-CSF from endothelial cells (By similarity). Uses only type II OSM receptor (heterodimers composed of OSMR and IL6ST). Involved in the maturation of fetal hepatocytes, thereby promoting liver development and regeneration.
Subcellular Location Secreted
Protein Families LIF/OSM family
Tissue Specificity Widely expressed. Expressed at higher levels in liver, skin and spleen.
Database Links

KEGG: rno:289747

STRING: 10116.ENSRNOP00000032548

UniGene: Rn.127158

Pathway Jak-STAT signaling pathway
PI3K-Akt signaling pathway

Related Products

Osm Antibodies

Osm Antibodies for Rat

Osm Proteins

Osm Proteins for Rattus norvegicus (Rat)

Osm ELISA Kit

Osm ELISA Kit for Rattus norvegicus (Rat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.