Recombinant Rat Oncostatin-M (Osm)

In Stock
Code CSB-EP723970RAb0
Abbreviation Recombinant Rat Osm protein
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
Osm; Oncostatin-M; OSM
Species
Rattus norvegicus (Rat)
Source
E.coli
Expression Region
26-208aa
Target Protein Sequence
KRGCSSSSPKLLSQLKSQANITGNTASLLEPYILHQNLNTLTLRAACTEHPVAFPSEDMLRQLSKPDFLSTVHATLGRVWHQLGAFRQQFPKIQDFPELERARQNIQGIRNNVYCMARLLHPPLEIPEPTQADSGTSRPTTTAPGIFQIKIDSCRFLWGYHRFMGSVGRVFEEWGDGSRRSRR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
26.2 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Rat Oncostatin-M (Osm) gets expressed in E. coli and includes the complete mature protein sequence, covering amino acids 26 to 208. The product comes with an N-terminal 10xHis-tag, which makes purification and detection more straightforward. SDS-PAGE analysis confirms the purity reaches above 85%, suggesting it should work reliably in research settings. Keep in mind this recombinant protein is strictly for research purposes—it's not appropriate for clinical or diagnostic use.

Oncostatin-M (Osm) belongs to the interleukin-6 cytokine family. This protein appears to play a significant role in controlling inflammation and how cells differentiate. Researchers often examine Osm because of its involvement in cell signaling pathways, especially those that influence immune responses and hematopoiesis. Its regulatory functions have made it a key target in studies looking at cellular growth and development.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Rat OSM is a cytokine that requires proper disulfide bond formation, specific folding, and dimerization for its biological activity through receptor binding. The E. coli expression system cannot perform the necessary post-translational modifications (particularly correct disulfide bonding) that are critical for OSM's native conformation and function. While the protein may be soluble, it is highly unlikely to achieve the correct folding needed for functional receptor binding and signaling activity. The probability of correct folding with biological activity is low.

1. Antibody Development and Validation Studies

This recombinant OSM serves as an excellent immunogen for generating antibodies against linear epitopes of rat OSM. The full-length mature sequence ensures comprehensive epitope coverage. The His-tag facilitates purification and immunization procedures. However, antibodies may not efficiently recognize conformational epitopes on the native, properly folded OSM found in biological systems.

2. ELISA Development and Optimization

This protein is well-suited as a standard for quantitative ELISA to detect immunoreactive OSM levels. The assay depends on antibody binding to linear epitopes, so the protein's folding state is less critical. The His-tag enables consistent immobilization for reliable standard curve generation.

3. Biochemical Characterization and Stability Studies

This is the essential first step to assess the protein's physical properties. Techniques like size-exclusion chromatography can determine oligomeric state, while circular dichroism can analyze secondary structure content and thermal stability. These studies provide critical quality control data but characterize a misfolded protein, not native OSM.

Final Recommendation & Action Plan

The E. coli expression system is fundamentally unsuitable for producing a functional version of this complex cytokine, limiting its applications to non-functional uses. The protein can be reliably used for Application 1 (Antibody Development) and Application 2 (as an ELISA standard). Application 3 (Biochemical Characterization) should be prioritized to understand the protein's physical properties. Cytokine-receptor interactions must be avoided entirely as it requires native protein structure and function. For functional OSM studies, the only valid approach is to use the protein expressed in a eukaryotic system (e.g., mammalian cells) that can provide proper disulfide bond formation and folding. 

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Growth regulator. Inhibits the proliferation of a number of tumor cell lines. It regulates cytokine production, including IL-6, G-CSF and GM-CSF from endothelial cells. Uses only type II OSM receptor (heterodimers composed of OSMR and IL6ST). Involved in the maturation of fetal hepatocytes, thereby promoting liver development and regeneration.
Gene References into Functions
  1. OSM is a key mediator for inducing differentiation of OC15-5 cells into hepatocytes PMID: 15743783
  2. In the immortalized mouse and primary cultured proliferative rat hepatocytes, treatment with OSM markedly increased mRNA and protein of claudin-2 together with formation of developed networks of TJ strands. PMID: 17434483
  3. OSM may not only play a role in the regulation of Sertoli cell proliferation and the initiation of spermatogenesis but may also play a role in the regulation of Leydig cell progenitor formation. PMID: 17996055
  4. Results indicate that osteosarcoma cells stably producing OSM do not develop resistance to this cytokine and thus could be a valuable new tool to study the anti-cancer effect of OSM in vivo. PMID: 19168167
Subcellular Location
Secreted.
Protein Families
LIF/OSM family
Tissue Specificity
Widely expressed. Expressed at higher levels in liver, skin and spleen.
Database Links
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*