Recombinant Rat Oncostatin-M (Osm)

In Stock
Code CSB-EP723970RAb0
Abbreviation Recombinant Rat Osm protein
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
Osm; Oncostatin-M; OSM
Species
Rattus norvegicus (Rat)
Source
E.coli
Expression Region
26-208aa
Target Protein Sequence
KRGCSSSSPKLLSQLKSQANITGNTASLLEPYILHQNLNTLTLRAACTEHPVAFPSEDMLRQLSKPDFLSTVHATLGRVWHQLGAFRQQFPKIQDFPELERARQNIQGIRNNVYCMARLLHPPLEIPEPTQADSGTSRPTTTAPGIFQIKIDSCRFLWGYHRFMGSVGRVFEEWGDGSRRSRR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
26.2 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Rat Oncostatin-M (Osm) gets expressed in E. coli and includes the complete mature protein sequence, covering amino acids 26 to 208. The product comes with an N-terminal 10xHis-tag, which makes purification and detection more straightforward. SDS-PAGE analysis confirms the purity reaches above 85%, suggesting it should work reliably in research settings. Keep in mind this recombinant protein is strictly for research purposes—it's not appropriate for clinical or diagnostic use.

Oncostatin-M (Osm) belongs to the interleukin-6 cytokine family. This protein appears to play a significant role in controlling inflammation and how cells differentiate. Researchers often examine Osm because of its involvement in cell signaling pathways, especially those that influence immune responses and hematopoiesis. Its regulatory functions have made it a key target in studies looking at cellular growth and development.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Antibody Development and Validation Studies

This recombinant rat Oncostatin-M protein works well as an immunogen for creating polyclonal or monoclonal antibodies that target rat OSM specifically. The N-terminal 10xHis tag makes purification simple and allows for easy immobilization during antibody screening assays. Since purity exceeds 85%, the protein quality appears sufficient for immunization protocols and follow-up antibody characterization work. Because it contains the full-length mature protein sequence, any antibodies developed should recognize native epitopes found in endogenous rat OSM.

2. Protein-Protein Interaction Studies

Researchers can use this His-tagged recombinant protein in pull-down assays to find and characterize OSM binding partners within rat cell lysates or tissue extracts. The 10xHis tag allows for immobilization on nickel-affinity matrices, making it possible to systematically screen for proteins that might interact with OSM. Such studies may help clarify OSM signaling pathways and receptor interactions in rat models. The purified protein also serves as a useful control in competitive binding experiments when validating specific interactions.

3. ELISA Development and Optimization

The recombinant rat OSM protein can function as either a standard or coating antigen when developing enzyme-linked immunosorbent assays to detect OSM in rat biological samples. Its His tag allows for oriented immobilization on nickel-coated plates, which could improve both assay sensitivity and reproducibility. Given its defined concentration and purity level, the protein offers a dependable reference standard for quantitative measurements. This application supports preclinical research that requires OSM quantification in rat serum, plasma, or tissue homogenates.

4. Biochemical Characterization and Stability Studies

The purified recombinant protein proves useful for investigating rat OSM's biochemical properties, including thermal stability, pH sensitivity, and optimal storage conditions. SDS-PAGE analysis can verify protein integrity under different experimental conditions. The protein may serve as a substrate for studying post-translational modifications or proteolytic processing that's relevant to OSM biology. These characterization studies provide essential baseline data for designing functional experiments and understanding how OSM protein behaves in laboratory conditions.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Growth regulator. Inhibits the proliferation of a number of tumor cell lines. It regulates cytokine production, including IL-6, G-CSF and GM-CSF from endothelial cells. Uses only type II OSM receptor (heterodimers composed of OSMR and IL6ST). Involved in the maturation of fetal hepatocytes, thereby promoting liver development and regeneration.
Gene References into Functions
  1. OSM is a key mediator for inducing differentiation of OC15-5 cells into hepatocytes PMID: 15743783
  2. In the immortalized mouse and primary cultured proliferative rat hepatocytes, treatment with OSM markedly increased mRNA and protein of claudin-2 together with formation of developed networks of TJ strands. PMID: 17434483
  3. OSM may not only play a role in the regulation of Sertoli cell proliferation and the initiation of spermatogenesis but may also play a role in the regulation of Leydig cell progenitor formation. PMID: 17996055
  4. Results indicate that osteosarcoma cells stably producing OSM do not develop resistance to this cytokine and thus could be a valuable new tool to study the anti-cancer effect of OSM in vivo. PMID: 19168167
Subcellular Location
Secreted.
Protein Families
LIF/OSM family
Tissue Specificity
Widely expressed. Expressed at higher levels in liver, skin and spleen.
Database Links
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*