Recombinant Rat Oncostatin-M (Osm)

In Stock
Code CSB-YP723970RA
Abbreviation Recombinant Rat Osm protein
MSDS
Size $368
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
Osm; Oncostatin-M; OSM
Species
Rattus norvegicus (Rat)
Source
Yeast
Expression Region
26-208aa
Target Protein Sequence
KRGCSSSSPKLLSQLKSQANITGNTASLLEPYILHQNLNTLTLRAACTEHPVAFPSEDMLRQLSKPDFLSTVHATLGRVWHQLGAFRQQFPKIQDFPELERARQNIQGIRNNVYCMARLLHPPLEIPEPTQADSGTSRPTTTAPGIFQIKIDSCRFLWGYHRFMGSVGRVFEEWGDGSRRSRR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
22.6 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Rat Oncostatin-M (Osm) is produced using a yeast expression system, which appears to ensure high yields of the full-length mature protein covering amino acids 26-208. The protein comes with an N-terminal 6xHis tag, making purification and detection more straightforward. SDS-PAGE analysis confirms the product displays a purity greater than 85%, though this level seems suitable for various research applications. It's provided as a research-use-only product with no detectable endotoxin levels.

Oncostatin-M (Osm) is a cytokine that likely plays a significant role in regulating inflammation, cell growth, and development across different biological systems. The protein appears to be involved in various signaling pathways, including those that may be critical for immune response modulation and tissue remodeling. Its importance in research stems from its involvement in these complex biological processes, making it a potentially valuable protein for studies in cellular signaling and cytokine interactions.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Rat OSM is a cytokine that requires precise folding, disulfide bond formation, and proper dimerization for its functional activity through receptor binding. The yeast expression system provides a eukaryotic environment that supports proper protein folding and disulfide bond formation, increasing the probability of correct folding compared to bacterial systems. However, the N-terminal 6xHis tag may potentially interfere with the protein's functional domains or receptor-binding interfaces. While yeast expression provides favorable conditions, experimental validation remains essential to confirm functional activity.

1. Antibody Development and Validation

This application is highly suitable regardless of folding status. Antibody development relies on antigenic sequence recognition rather than functional folding. If correctly folded (verified), the protein excels for generating conformation-sensitive antibodies that recognize native OSM epitopes. If misfolded/unverified, it remains suitable for producing antibodies against linear epitopes, which are still valuable for detection applications.

2. Protein-Protein Interaction Studies

This application requires proper folding validation. Cytokine-receptor interactions depend on precise tertiary and quaternary structure. If correctly folded (verified), the protein is suitable for identifying physiological interaction partners with OSM receptors (OSMRβ/gp130). If misfolded/unverified, there is a high risk of non-specific binding or failure to identify genuine interactions.

3. Comparative Species Analysis

This application depends on correct folding validation. Meaningful comparative studies require native protein conformation. If correctly folded (verified), the protein enables valid cross-species comparisons of structural and functional properties. If misfolded/unverified, comparative analyses would yield misleading results as differences may reflect misfolding rather than genuine species variations.

4. Biochemical Characterization and Stability Studies

These studies are essential for determining folding status regardless of functional state. If correctly folded (verified), characterization provides reliable data on dimerization, stability, and structural properties. If misfolded/unverified, analysis yields valuable physical property data for this specific preparation.

Final Recommendation & Action Plan

The yeast expression system provides favorable folding conditions for this cytokine, but experimental validation of structural integrity and functional activity is essential before reliable use in biological studies. Begin with Application 4 (Biochemical Characterization) to assess folding quality through size-exclusion chromatography (dimerization check), circular dichroism spectroscopy, and thermal stability assays. If correct folding is verified, proceed to validate functional activity through receptor binding assays. Once folding and activity are confirmed, proceed cautiously with Applications 2 and 3 for interaction studies and comparative analyses. Application 1 (antibody development) can proceed immediately regardless of folding status. If misfolding is detected, limit applications to linear epitope antibody production and basic biophysical characterization, avoiding all functional interaction and comparative studies. For reliable OSM research, always include appropriate activity controls and consider using mammalian-expressed protein for critical functional assays.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Growth regulator. Inhibits the proliferation of a number of tumor cell lines. It regulates cytokine production, including IL-6, G-CSF and GM-CSF from endothelial cells. Uses only type II OSM receptor (heterodimers composed of OSMR and IL6ST). Involved in the maturation of fetal hepatocytes, thereby promoting liver development and regeneration.
Gene References into Functions
  1. OSM is a key mediator for inducing differentiation of OC15-5 cells into hepatocytes PMID: 15743783
  2. In the immortalized mouse and primary cultured proliferative rat hepatocytes, treatment with OSM markedly increased mRNA and protein of claudin-2 together with formation of developed networks of TJ strands. PMID: 17434483
  3. OSM may not only play a role in the regulation of Sertoli cell proliferation and the initiation of spermatogenesis but may also play a role in the regulation of Leydig cell progenitor formation. PMID: 17996055
  4. Results indicate that osteosarcoma cells stably producing OSM do not develop resistance to this cytokine and thus could be a valuable new tool to study the anti-cancer effect of OSM in vivo. PMID: 19168167
Subcellular Location
Secreted.
Protein Families
LIF/OSM family
Tissue Specificity
Widely expressed. Expressed at higher levels in liver, skin and spleen.
Database Links
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*