Recombinant Human C-C chemokine receptor type 8 (CCR8), partial,Nanodiscs

Code CSB-CF004847HU2-N
Abbreviation Recombinant Human CCR8 protein, partial-Nanodisc
MSDS
Size $1078
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
G-protein coupled receptor, Receptor, Transducer
Alternative Names
CCR8; CKRL1; CMKBR8; CMKBRL2; C-C chemokine receptor type 8; C-C CKR-8; CC-CKR-8; CCR-8; CC chemokine receptor CHEMR1; Chemokine receptor-like 1; CKR-L1; GPR-CY6; GPRCY6; TER1; CD antigen CDw198
Species
Homo sapiens (Human)
Source
in vitro E.coli expression system
Expression Region
74-129aa
Target Protein Sequence
LLNLALSDLLFVFSFPFQTYYLLDQWVFGTVMCKVVSGFYYIGFYSSMFFITLMSV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
9.4 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
18-23 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for the chemokine CCL1/SCYA1/I-309. May regulate monocyte chemotaxis and thymic cell line apoptosis. Alternative coreceptor with CD4 for HIV-1 infection.
Gene References into Functions
  1. Authors demonstrate the pivotal role of CCR8(+) Treg cells in restraining immunity and highlight the potential clinical implications of this discovery. PMID: 28533380
  2. Role of Conserved Disulfide Bridges and Aromatic Residues in Extracellular Loop 2 of Chemokine Receptor CCR8 for Chemokine and Small Molecule Binding. PMID: 27226537
  3. High CCR8 expression is associated with high recurrence in kidney cancer. PMID: 26716905
  4. findings suggest that CCR8 expression in ALCL is more closely related to the presence of DUSP22 rearrangements than to cutaneous involvement and that the function of CCR8 may extend beyond its skin-homing properties in this disease PMID: 25390351
  5. Epidermal-derived vitamin D3 metabolites and prostaglandins provide an essential cue for the localization of CCR8+ immune surveillance T cells within healthy human skin. PMID: 26002980
  6. CCL1-CCR8 interaction may play a critical role in lymphocytic recruitment in IgG4-related sclerosing cholangitis and type 1 autoimmune pancreatitis, leading to duct-centred inflammation and obliterative phlebitis. PMID: 23811304
  7. Identification of human CCR8 as a CCL18 receptor. PMID: 23999500
  8. CCR8(+) myeloid cell subset is expanded in patients with cancer. PMID: 23363815
  9. Data show that CCR8 expression by newly activated naive T cells is regulated by skin-specific factor(s) derived primarily from epidermal keratinocytes. PMID: 23043070
  10. C-terminal clipping of chemokine CCL1/I-309 enhances CCR8-mediated intracellular calcium release and anti-apoptotic activity PMID: 22479563
  11. The functional data from human macrophages suggest a potential cross talk between the CCR8 and the Toll-like receptor 4 (TLR4) pathways, both of which are present in chronic obstructive pulmonary disease patients. PMID: 21976223
  12. There may be a role for CCR8 in the recruitment of T cells to the lung in asthmatics. PMID: 20455898
  13. CCR8 mediates rescue from dexamethasone-induced apoptosis via an ERK-dependent pathway PMID: 12525579
  14. found in the central nervous system and is associated with phagocytic macrophages PMID: 12547701
  15. CCR8 genes and surrounding genomic regions these genes are the result of the duplication of an ancestral gene prior to the divergence of teleost fish. PMID: 12551893
  16. Transfected human CCR8-dependent activation of the RAS/MAPK pathway mediates anti-apoptotic activity of I-309/ CCL1 and vMIP-I. PMID: 12645948
  17. The induction of CCR8 under conditions associated with vascular smooth muscle cell proliferation and migration raises the possibility that CCR8 may play an important role in vessel wall pathology. PMID: 14576057
  18. the axis CCL1-CCR8 links adaptive and innate immune functions that play a role in the initiation and amplification of atopic skin inflammation PMID: 15814739
  19. CCR8 ligands are allotropic, binding to distinct sites within CCR8; the human immune system may have evolved to use CCL7 as a selective antagonist of viral chemokine activity at CCR8 but not those of the host ligand PMID: 17023422
  20. CCR8 is expressed by a small and heterogeneous population of peripheral blood CD4 memory T cells enriched in T helper type 2 (Th2) effector and T regulatory (Treg) cells. PMID: 17082609
  21. CCR8-expressing CD4-positive T lymphocytes are preferentially recruited from the periphery into the lungs of asthmatic individuals, driven by elevated CCL1 levels produced almost exclusively by mast cells and basophils. PMID: 17641040
  22. The combination of 17beta-E(2) with the environmental pollutant TCDD is involved in the pathogenesis of endometriosis via up-regulating the chemokine CCR8-I-309. PMID: 17693327

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Database Links

HGNC: 1609

OMIM: 601834

KEGG: hsa:1237

STRING: 9606.ENSP00000326432

UniGene: Hs.113222

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*