Recombinant Human Zinc transporter ZIP6 (SLC39A6)

Code CSB-CF621669HU
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
SLC39A6
Uniprot No.
Alternative Names
SLC39A6; LIV1; ZIP6; Zinc transporter ZIP6; Estrogen-regulated protein LIV-1; Solute carrier family 39 member 6; Zrt- and Irt-like protein 6; ZIP-6
Species
Homo sapiens (Human)
Expression Region
29-755
Target Protein Sequence
FPQTTEKISPNWESGINVDLAISTRQYHLQQLFYRYGENNSLSVEGFRKLLQNIGIDKIK RIHIHHDHDHHSDHEHHSDHERHSDHEHHSEHEHHSDHDHHSHHNHAASGKNKRKALCPD HDSDSSGKDPRNSQGKGAHRPEHASGRRNVKDSVSASEVTSTVYNTVSEGTHFLETIETP RPGKLFPKDVSSSTPPSVTSKSRVSRLAGRKTNESVSEPRKGFMYSRNTNENPQECFNAS KLLTSHGMGIQVPLNATEFNYLCPAIINQIDARSCLIHTSEKKAEIPPKTYSLQIAWVGG FIAISIISFLSLLGVILVPLMNRVFFKFLLSFLVALAVGTLSGDAFLHLLPHSHASHHHS HSHEEPAMEMKRGPLFSHLSSQNIEESAYFDSTWKGLTALGGLYFMFLVEHVLTLIKQFK DKKKKNQKKPENDDDVEIKKQLSKYESQLSTNEEKVDTDDRTEGYLRADSQEPSHFDSQQ PAVLEEEEVMIAHAHPQEVYNEYVPRGCKNKCHSHFHDTLGQSDDLIHHHHDYHHILHHH HHQNHHPHSHSQRYSREELKDAGVATLAWMVIMGDGLHNFSDGLAIGAAFTEGLSSGLST SVAVFCHELPHELGDFAVLLKAGMTVKQAVLYNALSAMLAYLGMATGIFIGHYAENVSMW IFALTAGLFMYVALVDMVPEMLHNDASDHGCSRWGYFFLQNAGMLLGFGIMLLISIFEHK IVFRINF
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May act as a zinc-influx transporter.
Gene References into Functions
  1. ZIP6 deficiency disturbs intracellular Zn2+ homeostasis, leading to increased cell survival in hypoxia and reduced E-cadherin expression, indicating that decreased ZIP6 expression is strongly associated with resistance to hypoxia. PMID: 28833062
  2. SLC39A6 promotes aggressiveness of esophageal carcinoma cells by increasing intracellular levels of zinc, activating phosphatidylinositol 3-kinase signaling, and up-regulating genes that regulate metastasis. PMID: 28209530
  3. Upregulation of SLC39A6 is associated with hepatocellular carcinoma. PMID: 26684241
  4. SLC39A6 may have a tumor promoting role in esophageal carcinoma PMID: 26444413
  5. Knock-down of ZIP6 but not ZIP7 in MIN6 beta cells impaired the protective effects of GLP-1 on fatty acid-induced cell apoptosis, possibly via reduced activation of the p-ERK pathway PMID: 25969539
  6. drug resistance of ovarian cancer cells to trichostatin A may be related to expression of the LIV1 gene PMID: 25420545
  7. Zinc and its transporters, ZIP6 and ZIP10, are required for the breast cancer cells motility stimulated with high glucose level, such as in diabetes. PMID: 24587242
  8. a causative role for ZIP6 in cell motility and migration PMID: 23919497
  9. Down-regulated LIV-1 cells showed significant inhibition of proliferation in vitro and reduction of tumor growth in vivo. Furthermore, E-cadherin expression increased in LIV-1 siRNA expressing Hep-G2. PMID: 23437163
  10. SLC39A6 has an important role in the prognosis of esophageal squamous-cell carcinoma and may be a potential therapeutic target. PMID: 23644492
  11. Some studies correlate LIV-1 expression with a more aggressive cancer phenotype and increased likelihood for metastasis to lymph nodes. In contrast, other evidence suggests this transporter is associated with a more favorable prognosis. [review] PMID: 22852056
  12. The results of this study showed evidence for a positive correlation between LIV1 and ZnT6 insuperior temporal, occipital, and frontal gyri in patient with alzheimer disease. PMID: 22349685
  13. LIV-1 is involved in prostate cancer progression as an intracellular target of growth factor receptor signaling which promoted EMT and cancer metastasis PMID: 22110740
  14. LIV-1 mRNA upregulation is associated with the progression of cervical cancer but not with the development of endometrial carcinoma. PMID: 17959546
  15. The present study identifies LIV1 as a critical mediator responsible for HDACi-induced apoptosis. The effect of LIV1 is, at least in part, mediated by affecting intracellular zinc homeostasis. PMID: 19887557
  16. Zip6 over-expression is not an underlying mechanism initiating breast cancer, but in fact may play a "tumor-constraining" role. PMID: 19852955
  17. Structure-function analysis of LIV-1. PMID: 12839489
  18. data suggest that LIV-1 protein is a promising candidate for a novel marker for breast cancer patients with better outcome PMID: 15986450
  19. regulation of LIV-1 protein in human breast cancer xenografts PMID: 17786585
  20. Hence, our data provide the first evidence that LIV-1 mRNA is overexpressed in cervical cancer in situ and is involved in invasion of cervical cancer cells through targeting MAPK-mediated Snail and Slug expression. PMID: 17825787
  21. LIV-1 may be a regulator of E-cadherin PMID: 18330719
  22. Single nucleotide polymorphism in SLC39A6 gene is associated with acute lymphoblastic leukemia. PMID: 19066393
  23. LIV-1 enhances the aggressive phenotype through the induction of epithelial to mesenchymal transition in human pancreatic carcinoma cells. PMID: 19724917
  24. LIV-1 co-clusters with estrogen receptor alpha in microarray analysis of breast cancer biopsies. PMID: 11911440
  25. Review of LIV-1 and other LZT proteins. PMID: 12659941
  26. LIV-1, a member of the ZIP family of zinc transporters, is an integral plasma membrane protein that transports zinc into cells. PMID: 12839489
  27. LIV-1 is coregulated with estrogen receptor in some breast cancers. PMID: 12960427

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
ZIP transporter (TC 2.A.5) family
Tissue Specificity
Highly expressed in the breast, prostate, placenta, kidney, pituitary and corpus callosum. Weakly expressed in heart and intestine. Also highly expressed in cells derived from an adenocarcinoma of the cervix and lung carcinoma.
Database Links

HGNC: 18607

OMIM: 608731

KEGG: hsa:25800

STRING: 9606.ENSP00000269187

UniGene: Hs.79136

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
webinars: DT3C facilitates antibody internalization X