Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-CF004845MO |
| Product Type | Transmembrane Protein |
| Size | Pls inquiry other sizes |
| Uniprot No. | O54689 |
| Storage Buffer | Tris-based buffer,50% glycerol |
| Species | Mus musculus (Mouse) |
| Sequence | MNSTESYFGTDDYDNTEYYSIPPDHGPCSLEEVRNFTKVFVPIAYSLICVFGLLGNIMVV MTFAFYKKARSMTDVYLLNMAITDILFVLTLPFWAVTHATNTWVFSDALCKLMKGTYAVN FNCGMLLLACISMDRYIAIVQATKSFRVRSRTLTHSKVICVAVWFISIIISSPTFIFNKK YELQDRDVCEPRYRSVSEPITWKLLGMGLELFFGFFTPLLFMVFCYLFIIKTLVQAQNSK RHRAIRVVIAVVLVFLACQIPHNMVLLVTAVNTGKVGRSCSTEKVLAYTRNVAEVLAFLH CCLNPVLYAFIGQKFRNYFMKIMKDVWCMRRKNKMPGFLCARVYSESYISRQTSETVEND NASSFTM |
| Source | in vitro E.coli expression system |
| Gene Names | Ccr6 |
| Protein Names | Recommended name: C-C chemokine receptor type 6 Short name= C-C CKR-6 Short name= CC-CKR-6 Short name= CCR-6 Alternative name(s): KY411 CD_antigen= CD196 |
| Expression Region | 1-367 |
| Tag Info | N-terminal 10xHis-tagged |
| Protein Description | Full length protein |
| Storage | Store at -20°C, for extended storage, conserve at -20°C or -80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Receptor for the C-C type chemokine CCL20. Binds to CCL20 and subsequently transduces a signal by increasing the intracellular calcium ion levels |
| Subcellular Location | Cell membrane, Multi-pass membrane protein, Cell surface |
| Protein Families | G-protein coupled receptor 1 family |
| Tissue Specificity | Sperm. Mainly localized in the principal piece and neck region of the tail but is also found in the acrosomal region in a small percentage of sperm cells. Expressed in natural regulatory T cells (nTregs) and a subset of early thymocyte progenitor double-n |
| Database Links |
KEGG: mmu:12458 STRING: 10090.ENSMUSP00000095029 UniGene: Mm.8007 |
| Pathway | Chemokine signaling pathway |
Ccr6 Proteins for Mus musculus (Mouse)
| Code | Product Name | Source |
|---|---|---|
| CSB-YP004845MO1 CSB-EP004845MO1 CSB-BP004845MO1 CSB-MP004845MO1 |
Recombinant Mouse C-C chemokine receptor type 6(Ccr6),partial | Yeast E.coli Baculovirus Mammalian cell |
Recombinant Human Replication factor C subunit 1(RFC1),partial
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human Corticosteroid-binding globulin(SERPINA6)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Signal-regulatory protein beta-1(SIRPB1),partial
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Mouse Arginase-2, mitochondrial(Arg2)
Express system: E.coli
Species: Mus musculus (Mouse)
