Recombinant Mouse C-C chemokine receptor type 6(Ccr6)

Code CSB-CF004845MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O54689
Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Sequence MNSTESYFGTDDYDNTEYYSIPPDHGPCSLEEVRNFTKVFVPIAYSLICVFGLLGNIMVV MTFAFYKKARSMTDVYLLNMAITDILFVLTLPFWAVTHATNTWVFSDALCKLMKGTYAVN FNCGMLLLACISMDRYIAIVQATKSFRVRSRTLTHSKVICVAVWFISIIISSPTFIFNKK YELQDRDVCEPRYRSVSEPITWKLLGMGLELFFGFFTPLLFMVFCYLFIIKTLVQAQNSK RHRAIRVVIAVVLVFLACQIPHNMVLLVTAVNTGKVGRSCSTEKVLAYTRNVAEVLAFLH CCLNPVLYAFIGQKFRNYFMKIMKDVWCMRRKNKMPGFLCARVYSESYISRQTSETVEND NASSFTM
Source in vitro E.coli expression system
Gene Names Ccr6
Protein Names Recommended name: C-C chemokine receptor type 6 Short name= C-C CKR-6 Short name= CC-CKR-6 Short name= CCR-6 Alternative name(s): KY411 CD_antigen= CD196
Expression Region 1-367
Tag Info N-terminal 10xHis-tagged
Protein Description Full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for the C-C type chemokine CCL20. Binds to CCL20 and subsequently transduces a signal by increasing the intracellular calcium ion levels
Subcellular Location Cell membrane, Multi-pass membrane protein, Cell surface
Protein Families G-protein coupled receptor 1 family
Tissue Specificity Sperm. Mainly localized in the principal piece and neck region of the tail but is also found in the acrosomal region in a small percentage of sperm cells. Expressed in natural regulatory T cells (nTregs) and a subset of early thymocyte progenitor double-n
Database Links

KEGG: mmu:12458

STRING: 10090.ENSMUSP00000095029

UniGene: Mm.8007

Pathway Chemokine signaling pathway

Related Products

Ccr6 Proteins

Ccr6 Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.