Please click here to enter our new website >> Cusabio
 
 

 

Recombinant human Protein disulfide-isomerase protein
Product Name £º Recombinant human Protein disulfide-isomerase protein
Synonyms £º
Catalog Number £º CSB-RP002544h
Relevance £º This multifunctional protein catalyzes the formation, breakage and rearrangement of disulfide bonds. At the cell surface, seems to act as a reductase that cleaves disulfide bonds of proteins attached to the cell. May therefore cause structural modifications of exofacial proteins. Inside the cell, seems to form/rearrange disulfide bonds of nascent proteins. At high concentrations, functions as a chaperone that inhibits aggregation of misfolded proteins. At low concentrations, facilitates aggregation (anti-chaperone activity). May be involved with other chaperones in the structural modification of the TG precursor in hormone biogenesis. Also acts a structural subunit of various enzymes such as prolyl 4-hydroxylase and microsomal triacylglycerol transfer protein MTTP
Mol. Weight £º 53 KD
Product Info £º GST tagged
Source £º E.coli derived
Purity £º 95%
Image £º
Storage Buffer £º PBS buffer£¬20mM GSH
Storage £º Store at -20¡æ, for extended storage, conserve at -20¡æ or -80¡æ.
Notes £º Repeated freezing and thawing is not recommended. Store working aliquots at 4¡æ for up to one week.
AA sequence £º LRKSNFAEALAAHKYLLVEFYAPWCGHCKALAPEYAKAAGKLKAEGSEIRLAKVDATEESDLAQQYGVRG
YPTIKFFRNGDTASPKEYTAGREADDIVNWLKKRTGPAATTLPDGAAAESLVESSEVAVIGFFKDVESDS
AKQFLQAAEAIDDIPFGITSNSDVFSKYQLDKDGVVLFKKFDEGRNNFEGEVTKENLLDFIKHNQLPLVI
EFTEQTAPKIFGGEIKTHILLFLPKSVSDYDGKLSNFKTAAESFKGKILFIFIDSDHTDNQRILEFFGLK
KEECPAVRLITLEEEMTKYKPESEELTAERITEFCHRFLEGKIKPHLMSQELPEDWDKQPVKVLVGKNFE
DVAFDEKKNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHENIVIAKMDSTANEVEAVKVHSFPTLKFFPA
SADRTVIDYNGERTLDGFKKFLESGGQDGAGDDDDLEDLEEAEEPDMEEDDDQKAVKDEL-
Referrences £º [1] "Molecular cloning of the beta-subunit of human prolyl 4-hydroxylase. This subunit and protein disulphide isomerase are products of the same gene."
Pihlajaniemi T., Helaakoski T., Tasanen K., Myllylae R., Huhtala M.-L., Koivu J., Kivirikko K.I.
EMBO J. 6:643-649(1987) [PubMed: 3034602] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA].

[2] "The nucleotide sequence of a human cellular thyroid hormone binding protein present in endoplasmic reticulum."
Cheng S.-Y., Gong Q.-H., Parkison C., Robinson E.A., Appella E., Merlino G.T., Pastan I.
J. Biol. Chem. 262:11221-11227(1987) [PubMed: 3611107] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA].

 

ELISA Kit
Other Kit

 

Native Protein
Recombinant Protein
In Stock
Order now, ship in 6 weeks

 

Immune Serum

 

Primary Antibodies
Monoclonal Antibodies
Polyclonal Antibodies
Secondary Antibodies

 

 

RT-PCR Primer
Clone

 

 

Diagnostic Antigen
Diagnostic Antibody

 

 

Home    |    About Us    |    Products    |    Technical Support    |    Distributor    |    Contact Us    |    Privacy Statement

Copyright © 2010 www.cusabio.com All Rights Reserved.