Please click here to enter our new website >> Cusabio
 
 

 

Recombinant human Transforming protein RhoA protein
Product Name Recombinant human Transforming protein RhoA protein
Synonyms
Catalog Number CSB-RP008754h
Relevance Regulates a signal transduction pathway linking plasma membrane receptors to the assembly of focal adhesions and actin stress fibers. Serves as a target for the yopT cysteine peptidase from Yersinia pestis, vector of the plague, and Yersinia pseudotuberculosis, which causes gastrointestinal disorders. May be an activator of PLCE1. Activated by ARHGEF2, which promotes the exchange of GDP for GTP. Essential for the SPATA13-mediated regulation of cell migration and adhesion assembly and disassembly.
Mol. Weight 22 KD
Product Info GST tagged
Source E.coli derived
Purity 95%
Image
Storage Buffer 6M guanidine hydrochloride, 20mM Tris
Storage Store at -20, for extended storage, conserve at -20 or -80.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4 for up to one week.
AA sequence MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLR
PLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVK
PEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCL
Referrences [1] "Nucleotide sequence of human rho cDNA clone 12."
Yeramian P., Chardin P., Madaule P., Tavitian A.
Nucleic Acids Res. 15:1869-1869(1987) [PubMed: 3822842] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA].

[2] "Sequence of rho small GTP-binding protein cDNAs from human retina and identification of novel 5' end cloning artifacts."
Fagan K.P., Oliveira L., Pittler S.J.
Exp. Eye Res. 59:235-237(1994) [PubMed: 7835413] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA].
Tissue: Retina.

[3] "cDNA clones of human proteins involved in signal transduction sequenced by the Guthrie cDNA resource center (www.cdna.org)."
Puhl H.L. III, Ikeda S.R., Aronstam R.S.
Submitted (APR-2002) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
Tissue: Brain.

 

ELISA Kit
Other Kit

 

Native Protein
Recombinant Protein
In Stock
Order now, ship in 6 weeks

 

Immune Serum

 

Primary Antibodies
Monoclonal Antibodies
Polyclonal Antibodies
Secondary Antibodies

 

 

RT-PCR Primer
Clone

 

 

Diagnostic Antigen
Diagnostic Antibody

 

 

Home    |    About Us    |    Products    |    Technical Support    |    Distributor    |    Contact Us    |    Privacy Statement

Copyright © 2010 www.cusabio.com All Rights Reserved.