Recombinant Human C-X-C motif chemokine 10(CXCL10)

In Stock
Code CSB-AP003501HU
Product Type Chemokine
Size US$104
Uniprot No. P02778
Lead Time 5-10 business days
Storage Buffer Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.0
Alias C-X-C Motif Chemokine 10; 10 kDa Interferon Gamma-Induced Protein; Gamma-IP10; IP-10; Small-Inducible Cytokine B10; CXCL10; INP10; SCYB10
Species Homo sapiens (Human)
Biological_Activity The ED50 as determined by its ability to chemoattract human CXCR3 transfected BaF3 mouse proB cells is typically 0.02-0.06 μg/mL.
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
Research Area Immunology
Source E.coli
Gene Names CXCL10
Expression Region 22-98aa
Tag Info Tag-Free
Mol. Weight 8.6 kDa
Protein Description Full Length of Mature Protein
Still Have Questions? Leave a Message or Start an on-line Chat
Function Chemotactic for monocytes and T-lymphocytes. Binds to CXCR3.
Subcellular Location Secreted
Protein Families Intercrine alpha (chemokine CxC) family
Database Links

HGNC: 10637

OMIM: 147310

KEGG: hsa:3627

STRING: 9606.ENSP00000305651

UniGene: Hs.632586

Pathway Chemokine signaling pathway
TNF signaling pathway
IL-17 signaling pathway
Toll-like receptor signaling pathway

Related Products

CXCL10 Antibodies

CXCL10 Antibodies for Homo sapiens (Human)

CXCL10 Proteins

CXCL10 Proteins for Homo sapiens (Human)

CXCL10 ELISA Kit

CXCL10 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.