Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Activity
The ED50 as determined by its ability to chemoattract human CXCR3 transfected BaF3 mouse proB cells is typically 0.02-0.06 μg/mL.
Alternative Names
Interferon gamma induced factor MOB1; mouse; homolog of; Interferon gamma induced protein 10; 10 kDa interferon gamma induced protein; 10 kDa interferon gamma-induced protein; C X C motif chemokine 10; C7; Chemokine (C X C motif) ligand 10; Chemokine CXC motif ligand 10; Crg 2; CRG2; CXCL10; CXCL10(1-73); CXL10_HUMAN; Gamma IP10; Gamma-IP10; gIP 10; GIP10; IFI10; INP 10; INP10; Interferon activated gene 10; Interferon activated gene 10; Interferon gamma induced cell line; Interferon inducible cytokine IP 10; Interferon inducible cytokine IP10; IP 10; IP-10; Mob 1; MOB1; Protein 10 from interferon (gamma) induced cell line; SCYB10; Small inducible cytokine B10; Small inducible cytokine B10 precursor; Small inducible cytokine subfamily B (Cys X Cys) member 10; Small inducible cytokine subfamily B CXC member 10; Small inducible cytokine subfamily B; member 10; Small-inducible cytokine B10
Species
Homo sapiens (Human)
Expression Region
22-98aa
Complete Sequence
VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
Protein Length
Full Length of Mature Protein
Buffer
Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
