Recombinant Human C-X-C motif chemokine 10(CXCL10)

Code CSB-YP006240HU
Size US$1298
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names CXCL10
Uniprot No. P02778
Research Area Immunology
Alternative Names Interferon gamma induced factor MOB1; mouse; homolog of; Interferon gamma induced protein 10; 10 kDa interferon gamma induced protein; 10 kDa interferon gamma-induced protein; C X C motif chemokine 10; C7; Chemokine (C X C motif) ligand 10; Chemokine CXC motif ligand 10; Crg 2; CRG2; CXCL10; CXCL10(1-73); CXL10_HUMAN; Gamma IP10; Gamma-IP10; gIP 10; GIP10; IFI10; INP 10; INP10; Interferon activated gene 10; Interferon activated gene 10; Interferon gamma induced cell line; Interferon inducible cytokine IP 10; Interferon inducible cytokine IP10; IP 10; IP-10; Mob 1; MOB1; Protein 10 from interferon (gamma) induced cell line; SCYB10; Small inducible cytokine B10; Small inducible cytokine B10 precursor; Small inducible cytokine subfamily B (Cys X Cys) member 10; Small inducible cytokine subfamily B CXC member 10; Small inducible cytokine subfamily B; member 10; Small-inducible cytokine B10
Species Homo sapiens (Human)
Source Yeast
Expression Region 22-98aa
Target Protein Sequence VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 10.6kDa
Protein Length Full Length of Mature Protein
Tag Info N-terminal 6xHis-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Chemotactic for monocytes and T-lymphocytes. Binds to CXCR3.
Gene References into Functions
  1. results of study suggest that the CXCL10 overexpression in the salivary glands is caused mainly by IFN-gamma-stimulated salivary gland ductal cells. PMID: 29549479
  2. Urinary CXCL10 reflects subclinical inflammation within the tubulointerstitial and peritubular capillary spaces, but not the vascular/systemic compartments PMID: 28902772
  3. CXCL10 in the serum of patients with vitiligo and alopecia areata was significantly elevated compared with healthy controls, but was similar between patients with vitiligo and AA PMID: 27863059
  4. IP-10 might be involved in the pathogenesis of thrombocytopenia (T), anasarca (A), fever (F), reticulin fibrosis (R), and organomegaly (O) -idiopathic Multicentric Castleman disease. PMID: 28205564
  5. CXCL10, not CXCL9 or CXCL11, induced IL-9 expression in the liver tissue. PMID: 29860220
  6. serum IP-10 level and the IFN-gamma/IL-4 ratio have great potential to predict significant fibrosis among chronic hepatitis B patients. PMID: 28067328
  7. No association between IP-10 serum-levels and cancer-related fatigue. PMID: 30188739
  8. CXCL10 rs1439490 G/G is positively associated with seronegative occult hepatitis C virus infection and antiviral treatment outcome. PMID: 29853737
  9. Age-related epigenetic and genetic factors which contribute to the dysregulation of CXCL10. PMID: 29223680
  10. COMMD7 activates CXCL10 production by regulating NFkappaB and the production of ROS. The present study highlighted the role of COMMD7 in the development of HCC, and provides novel options for anticancer drug design. PMID: 29532873
  11. Nab-PTX treatment could increase CXCL10 expression. PMID: 29902349
  12. The frequency of non-classical monocytes spontaneously producing CXCL10 was increased in both limited and diffuse systemic sclerosis PMID: 29127442
  13. serum levels in active vitiligo significantly elevated compared to those in stable vitiligo patients PMID: 29115683
  14. Plasma CXCL10 levels are significantly higher in SPs pre-HAART and RPs pre-HAART when compared with HIV-negative controls. PMID: 29122683
  15. Hepatitis b vaccine was efficient in enhancing IP-10 level with HBsAg clearance, or reduction to a favorable level. PMID: 28802168
  16. Results show that the expression of IP-10 in peripheral blood of patients with HBV-associated acute-on-chronic liver failure (HBV-ACLF) was significantly high and correlated with the severity of liver failure. IP-10 played an important role in the pathogenesis and progression of HBV-ACLF. PMID: 29058291
  17. Differential regulation of cytokine release at both transcriptional and post-transcriptional levels, suppresses type-I-IFN induction yet allows for CXCL10 secretion during imDNA-induced cellular stress. PMID: 27941826
  18. the elevated concentrations of CXCL13, CXCL8, and CXCL10 or their increasing CSF/serum ratios may be potential biomarkers of neurosyphilis PMID: 27650493
  19. Results highlight the role of phytohaemagglutin-stimulated peripheral blood mononuclear cells from patients with Alzheimer's disease on the expression of chemokines CXCL10 and CCL4 by endothelial cells and H4 cell line (mimicking the brain parenchyma) in a human blood brain barrier model. PMID: 28413983
  20. viral and bacterial co-infection modulates the JAK-STAT signaling pathway and leads to exacerbated IP-10 expression, which could play a major role in the pathogenesis of pneumonia. PMID: 27922126
  21. Study suggests that rs56061981 and rs56216945 in CXCL10 gene promoter contribute COPD susceptibility. PMID: 29285564
  22. Our findings showed that the assessment of serum IP-10 level could be a predictive factor for SVR and it was associated with fibrosis, necroinflammatory activity, significant steatosis and IR in patients with chronic HCV infection. PMID: 28862188
  23. In conclusion, IL-29 enhanced CXCL10 production in human oral epithelial cells via the p38 MAPK, STAT3, and NF-kappaB pathways, which might control Th1-cell accumulation in periodontal lesions and be involved in pathological processes in periodontal disease. PMID: 28753407
  24. Interferon-gamma-inducible protein 10 (IP-10) directly promoted hepatocyte apoptosis, and baseline IP-10 levels may predict the decrease in the hepatitis B surface antigen levels after entecavir therapy in patients with chronic hepatitis B. PMID: 28614914
  25. data indicate that IP-10 is associated with disease activity and perseverance of rheumatoid arthritis. PMID: 28592626
  26. CXCL10 in addition to IFN-gamma can be used to differentiate among Mycobacterium tuberculosis infection possibilities. PMID: 28610785
  27. Increased amniotic fluid CXCL10 concentration is associated with chronic chorioamnionitis or maternal anti-fetal rejection, whereas increased amniotic fluid IL-6 concentration is associated with acute histologic chorioamnionitis. PMID: 28544362
  28. Cord blood CXCL10 levels were negatively associated with mite sensitization at age 3. A high cord blood CCL22/CXCL10 chemokine ratio was significantly associated with a higher risk of allergic sensitization at age 3. PMID: 27863395
  29. CXCL10/IP-10 transcript showed up to 20 fold-increase, with similar changes detectable at the protein level in melanoma cells overexpressing PDFGRA. PMID: 27764787
  30. this study suggests that GG genotype of CXCL10 -135G/A (rs56061981) polymorphism decreased CXCL10 expression in T cells which may have defective recruitment of mononuclear cells at the site of infection as well granuloma formation and in turn contribute to progression of tuberculosis PMID: 28336310
  31. The regular early post-transplantation monitoring of urinary miR-155-5p and CXCL10 can help in the prognosis of acute rejection and graft dysfunction after kidney transplantation. PMID: 28880456
  32. gene polymorphisms of IL-8(-251T/A) and IP-10(-1596C/T) are associated with susceptibility and progression of type 2 diabetic retinopathy in a northern Chinese population PMID: 27935598
  33. Higher serum levels of CXCL10 are found in patients with non-segmental vitiligo (NSV) and NSV + autoimmune thyroiditis than in controls. PMID: 28698095
  34. results indicated that CXCL10, a pro-inflammatory chemokine, might be involved in the abnormal immune response in aplastic anaemia. PMID: 28411045
  35. IP-10 low in the tumor microenvironment can be used as potential indicators for the progression of non-small cell lung cancer PMID: 28375674
  36. The serum IP10 concentrations increase in women with polycystic ovary syndrome (PCOS), moreover, IP10 appears to be correlated with the inflammatory and Insulin resistance statuses of PCOS. IP10 may be a potential biomarker to estimate the disease activity of PCOS. PMID: 28051885
  37. EGF and IP-10 were significantly elevated and GRO levels were lower in the tear profile of HIV patients with dry eye disease (DED) compared to immunocompetent patients with DED. PMID: 27585367
  38. Determination of serum IP-10 levels before treatment could be useful for predicting favorable virologic response to TVR-based triple therapy, especially in patients with IL28B non-TT genotype. PMID: 27541605
  39. In lipotoxic hepatocytes, MLK3 activates a MAPK signaling cascade, resulting in the activating phosphorylation of STAT1, and CXCL10 transcriptional upregulation. PMID: 28262979
  40. Neuroendocrine-like cells promote the chemotaxis activity of tumor-associated macrophages (TAM) via CXCL10 and CXCL11. PMID: 27034164
  41. These results showed that the higher levels of CXCL10, CCL20 and CCL22 were associated with ischemic heart disease. The serum levels of chemokines may influence by the certain traditional risk factors of IHD and some studied SNPs, but did not influence by treatment and gender of patients. PMID: 27152707
  42. High CXCL10 expression is associated with clear-cell renal cell carcinoma. PMID: 26910919
  43. a massive and selective serum CXCL10 response in R. conorii-infected patients, likely reflecting release from infected endothelial cells characterized by infiltrating T cells and monocytes. PMID: 27180202
  44. The strongest OR was for CXCL8 (interleukin-8) in serum (96.8, 95% CI: 11.9-790.2). Of these 15 markers, 6 were also significantly elevated in serum from Chile (CCL20, C-reactive protein, CXCL8, CXCL10, resistin, serum amyloid A). PMID: 27173614
  45. These findings elucidate an NFAT-MAPK signaling paradigm for induction of isletokine expression in beta-cells and reveal IP-10 as a primary therapeutic target to prevent beta-cell-induced inflammatory loss of graft function after islet cell transplantation. PMID: 28855240
  46. High urine CXCL10 level is associated with acute rejection in Histologically Stable Kidney transplant Recipients. PMID: 26694099
  47. IL-10, IL-17 and IP-10 response to tubercular antigens act as potent discriminative markers for active tuberculosis among pulmonary tuberculosis suspects. PMID: 27450011
  48. The performance of IFNG release assays is robust despite variations in the incubation temperature between 37 degrees C and 39 degrees C for the diagnosis of latent tuberculosis infection. PMID: 27156612
  49. A novel function of CXCL10 in mediating monocyte production of proinflammatory cytokines in inflammatory bowel diseases has been described. PMID: 28899907
  50. CXCL10 is a circulating inflammatory marker elevated in advanced heart failure. PMID: 27271043
  51. Data suggest that chemokine CXCL10 may serve as a disease activity marker in early rheumatoid arthritis. PMID: 28148302
  52. IL-27 stimulation activated STAT1 and STAT3 in HeLa and T98G cells, suggesting that IL-27 engages the STAT1/3 pathway, which then leads to the upregulation of IL-6, IP-10, and MIG PMID: 27617644
  53. Data suggest that, unlike non-metastatic intestinal epithelial cells (IECs), metastatic IECs express TLR3 and that TLR3 agonists induce inflammatory cytokine (CXCL10) production and promote invasiveness of IECs. (TLR3 = toll-like receptor 3; CXCL10 = chemokine [C-X-C motif] ligand 10 protein) PMID: 28717003
  54. Studied perinatally HIV-infected children on cART and in good clinical status with respect to HIV disease; found that high plasma levels of Interferon-gamma-inducible protein 10 (IP10) associate with increased numbers of abnormal memory B cells (MBCs) phenotypes. IP10 appears to be a sensitive marker to predict the presence of exhausted MBC. PMID: 28419006
  55. These data suggest that elevated IP-10 levels may impair NK cell function during HIV infection and that IP-10/CXCR3 blocking may be a novel therapeutic strategy in the control and functional cure of HIV. PMID: 28465448
  56. Results provide evidence for an association between an increase level of CCL21 and IP-10 in the blood and pulmonary involvement in systemic lupus erythematosus patients. PMID: 27614982
  57. findings show that S. aureus downregulates superantigen-induced IP-10 production and prevents Th1 cell recruitment; S. aureus triggered activation of MAPKs p38 and ERK, as well as inhibition of STAT1 signaling in monocytes, altogether contributing to the downregulation of IP-10 PMID: 28122962
  58. Mothers of children affected by autoimmune congenital heart block did not have significantly elevated levels of IP-10 expression. PMID: 28501799
  59. results indicate that rhinovirus (RV) stimulates CXCL-10 expression via the IL-33/ST2 signaling axis, and that TLR2 signaling limits RV-induced CXCL-10 via IRAK-1 depletion at least in airway epithelial cells PMID: 27503209
  60. This would suggest that the change in IP-10 is genotypically driven, while the change in IL-6 may be reflective of systemic lupus erythematosus (SLE) transition status. These data suggest that IFIH1 may contribute to SLE pathogenesis via altered inflammatory mechanisms. PMID: 28234905
  61. HCV infection leads to upregulated expression of CXCL10 in brain microvascular endothelial cells, which is probably via the phosphorylation of NF-kappaB. PMID: 26895737
  62. The results indicate significantly increased levels of CXCL10 protein in the urine at the time of allograft rejection. This association of urinary CXCL10 protein levels with rejection could provide an additional tool for the non-invasive monitoring of allograft rejection. PMID: 28246678
  63. this study shows that melanoma peptides vaccination and intratumoral administration of IFNgamma increases production of CXCL10 in patient tumors PMID: 27522581
  64. analysis of plasma CXCL10, sCD163 and sCD14 in virological suppression and risk of cardiovascular disease PMID: 27355513
  65. In human Idiopathic Pulmonary Fibrosis patient samples the study established a strong negative correlation in the mRNA expression levels of gremlin-1 and CXCL10. The results suggest that in addition to regulation of epithelial-mesenchymal crosstalk during tissue injury, gremlin-1 modulates inflammatory cell recruitment and anti-fibrotic chemokine production in the lung. PMID: 27428020
  66. Increased levels of inflammatory biomarkers in patients with bullous pemphigoid, such as CXCL10, favor neutrophil- and monocyte-associated MMP-9 release and disease relapse and opened new therapeutic horizons in patients with this autoimmune disease PMID: 27637385
  67. study indicates that the interferon-inducible, ELR(-) chemokine CXCL10 kills the Gram-positive pathogen Bacillus anthracis through multiple molecular mechanisms. PMID: 27165799
  68. CXCL10 was significantly higher in psoriasis patients who developed psoriatic arthritis than in psoriasis patients who did not develop arthritis. PMID: 27389865
  69. IP-10 serum increase or TARC/IP-10 ratio decrease along with abnormal hepatic enzymatic alteration could signify early rejection of the transplanted liver. PMID: 28245475
  70. TLR9 ligands may contribute to the immunopathogenesis of sarcoidosis via induction of CXCL10 release in the alveolar macrophages. PMID: 27390897
  71. The CXCL10/CXCR3 axis mediates T-cell recruitment into the skin in progressive vitiligo. Blocking this chemotactic mechanism may present a new form of therapy. Serum CXCL10 may be a novel biomarker in monitoring disease activity and guiding treatment of progressive vitiligo. PMID: 26801009
  72. Potential immune markers, including interleukin 1 receptor antagonist, interferon gamma-inducible protein 10, hepatocyte growth factor, soluble p75 tumor necrosis factor alpha receptor, vascular cell adhesion molecule 1, and matrix metalloproteinase 2, were significantly associated with significant plasma leakage during Dengue virus infection. PMID: 28077582
  73. Results show that IP-10 was higher in non-alcoholic fatty liver (NAFL) than in controls and higher in non-alcoholic steatohepatitis than in NAFL patients. PMID: 27826704
  74. Urinary CCL2:Cr/CXCL10:Cr alone have similar prognostic performance after kidney transplantation, but when both are elevated, this suggests a worse prognosis. PMID: 27548845
  75. Results indicated that HGF may promote angiogenesis by not only increasing the expression of VEGF but also by decreasing the expression of an angiostatic chemokine, CXCL10 in keratinocytes. PMID: 27718226
  76. T-cell attractant chemokine CXCL10 showed an almost 10-fold higher expression in the peri-islet area than in the islet in insulitic islets from living patients with recent-onset T1D, possibly partly explaining the localization of T cells mainly to this region. PMID: 27422384
  77. silencing of IL1B plus dexamethasone-induced DUSP1 significantly reduced IRF1 expression. IL1B-induced expression of CXCL10 was largely insensitive to dexamethasone, whereas other DUSP1-enhanced, IRF1-dependent mRNAs showed various degrees of repression. PMID: 27551049
  78. results support the notion that CXCL9 and CXCL10 exert tumour-suppressive function by TIL recruitment in human ovarian cancer PMID: 27490802
  79. Data provide first evidence for a link between oncogenic JAK2V617F signaling and cell intrinsic induction of CXCL10 induced by activated NFkB signaling. PMID: 28233092
  80. this paper shows that the combined detection of IL-10, IL-17, and CXCL10 at 1-2 weeks post-operation could predict acute rejection following adult liver transplantation with 97% specificity and 94% sensitivity PMID: 27498551
  81. The present data suggests a potential role of CXCL10 in the oncogenic function of COMMD7. PMID: 28142122
  82. Melatonin decreased CXCL10 and MMP-1 production and increased TIMP-1 production in IL-1beta-stimulated Human Periodontal Ligament Cells PMID: 27271323
  83. this study shows that serum IP-10 levels of acute asthma group are higher than controlled asthma group, and can be used to predict viral-induced acute asthma PMID: 27955890
  84. IP-10 complexes with CXCR3, which in turn activates the ERK1/2 pathway, thus resulting in upregulation of p-CREB and increased vascular smooth muscle cell proliferation. PMID: 28111710
  85. p43 induces both the mRNA and protein expression of IP-10. PMID: 27574027
  86. CCL2 and CXCL10 play important roles in the progression of obesity-related metabolic complications in children. PMID: 27375180
  87. Data show that plasma C-X-C motif chemokine 10 (CXCL10) was increased in ten patients (type I patients) but decreased in the other 10 patients (type II patients). PMID: 26462839
  88. CXCL10/CXCR3 axis promotes gastric cancer cell invasion and migration by upregulating MMP-2 and MMP-9 production via PI3K/AKT pathway. PMID: 27470388
  89. MCP-1, MIP-1beta, and IP-10 may modify the pathologic features of Rhegmatogenous Retinal Detachment. PMID: 28074184
  90. In contrast to elevated 1st trimester levels of IP-10 previously found in the maternal serum of women who later developed preeclampsia, this study found lower umbilical cord IP-10 and ITAC plasma levels in near-term gestations with established severe preeclampsia. PMID: 25741937
  91. the results of the present study showed higher serum levels of CXCL10 in patients with breast cancer. The levels of CXCL10 also increased with advanced stageswhich represent that the chemokine may contribute in thetumor development. PMID: 27002757
  92. Oral lipid loading is linked to reduced circulating pro-inflammatory chemokines CCL2, IP-10, and chemerin and to increased RANTES levels, suggesting that dietary lipids affect immune function. PMID: 26950614
  93. Donor interleukin-22 and host type I interferon signaling pathway participate in intestinal graft-versus-host disease via STAT1 activation and CXCL10. PMID: 26153763
  94. The role of IP-10 in in Graves' disease and Graves'ophthalmopathy [review] PMID: 24999581
  95. CXCL10 role in autoimmune thyroiditis [review] PMID: 24999582
  96. Data suggest that Th1 (IFN-gamma-inducible protein-10 IP-10/CXCL10) and Th2 (thymus and activation regulated chemokine TARC/CCL17) and (macrophage derived chemokine MDC/CCL22) cooperatively play a role in the development of ankylosing spondylitis (AS). PMID: 26827189
  97. IP-10 role in cryoglobulinemia [review] PMID: 25203349
  98. High CXCL10 expression is associated with Thoracic Esophageal Squamous Cell Carcinoma. PMID: 26464192
  99. serum level preoperative period may serve as a predictive parameter for early liver allograft dysfunction PMID: 26658573
  100. Both CXCL10 and CXCR3 appeared to be useful in differentiating T1R reaction in borderline leprosy while CXCR3 alone differentiated BT from BT-T1R PMID: 26831417

Show More

Hide All

Subcellular Location Secreted
Protein Families Intercrine alpha (chemokine CxC) family
Database Links

HGNC: 10637

OMIM: 147310

KEGG: hsa:3627

STRING: 9606.ENSP00000305651

UniGene: Hs.632586

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1