Recombinant Human C-X-C motif chemokine 10(CXCL10)

Code CSB-YP006240HU
Product Type Recombinant Protein
Size US$2010
Uniprot No. P02778
Relevance Chotactic for monocytes and T-lymphocytes. Binds to CXCR3.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias 10 kDa interferon gamma-induced protein ;Gamma-IP10 ;IP-10Small-inducible cytokine B10
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
Research Area Immunology
Source Yeast
Gene Names CXCL10
Protein Names Recommended name: C-X-C motif chemokine 10 Alternative name(s): 10 kDa interferon gamma-induced protein Short name= Gamma-IP10 Short name= IP-10 Small-inducible cytokine B10 Cleaved into the following chain: 1. CXCL10(1-73)
Expression Region 22-98aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 10.6kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Chemotactic for monocytes and T-lymphocytes. Binds to CXCR3.
Subcellular Location Secreted
Protein Families Intercrine alpha (chemokine CxC) family
Database Links

HGNC: 10637

OMIM: 147310

KEGG: hsa:3627

STRING: 9606.ENSP00000305651

UniGene: Hs.632586

Pathway Chemokine signaling pathway
TNF signaling pathway
IL-17 signaling pathway
Toll-like receptor signaling pathway

Related Products

CXCL10 Antibodies

CXCL10 Antibodies for Homo sapiens (Human)

CXCL10 Proteins

CXCL10 Proteins for Homo sapiens (Human)

CXCL10 ELISA Kit

CXCL10 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.