Recombinant Human Basic Fibroblast Growth Factor(FGF2),partial (Active) (GMP)

In StockGMP
Code CSB-AP005911HU
Product Type Growth Factor
Size $1588Purchase it in Cusabio online store
(Shop online in the US. Customers outside the US,
please order from local distributors.)
Uniprot No. P09038
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Lyophilized from a 0.2 μm filtered concentrated solution in 20 mM Tris-HCl, pH 7.6, with 150mM NaCl.
Alias Basic fibroblast growth factor,bFGF,Heparin-binding growth factor 2,HBGF-2
Species Homo sapiens (Human)
Biological_Activity Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine balb/c 3T3 cells is less than 0.05 ng/ml, corresponding to a specific activity of > 2.0 × 107 IU/mg.
Purity > 98 % by SDS-PAGE and HPLC analyses.
Endotoxin Less than 0.01 EU/μg of rHubFGF GMP as determined by LAL method.
Sequence M+PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Research Area Signal Transduction
Source E.Coli
Gene Names FGF2
Expression Region 143-288aa
Tag Info Tag-Free
Mol. Weight 16.5 kDa
Protein Description Partial
PubMed ID 3472745; 3780670; 2538817; 19054851; 15815621; 1785797; 2435575; 1721615; 8564983; 3579930; 2435284; 3964259; 3732516; 1417798; 1885605; 8663044; 10358027; 11509569; 11964394; 16257968; 18669637; 20230531; 15863030; 20094046; 22321063; 23469107; 25114211;
Still Have Questions? Leave a Message or Start an on-line Chat
Function Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro. Can induce angiogenesis
Subcellular Location Secreted, Nucleus
Protein Families Heparin-binding growth factors family
Tissue Specificity Expressed in granulosa and cumulus cells. Expressed in hepatocellular carcinoma cells, but not in non-cancerous liver tissue.
Database Links

HGNC: 3676

OMIM: 134920

KEGG: hsa:2247

STRING: 9606.ENSP00000264498

UniGene: Hs.284244

Pathway MAPK signaling pathway
PI3K-Akt signaling pathway
Regulation of actin cytoskeleton
Ras signaling pathway
Signaling pathways regulating pluripotency of stem cells
Rap1 signaling pathway

Related Products

FGF2 Antibodies

FGF2 Antibodies for Homo sapiens (Human)

FGF2 Antibodies for Human

FGF2 ELISA Kit

FGF2 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.