Recombinant Human Transforming growth factor beta-3(TGFB3),Partial (Active)

In Stock
Code CSB-AP004051HU
Product Type Growth Factor
Size $195Purchase it in Cusabio online store
(Shop online in the US. Customers outside the US,
please order from local distributors.)
Uniprot No. P10600
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Lyophilized from a 0.2 μm Filtered 4 mM HCl
Alias Transforming growth factor beta-3;TGFB3;TGF-beta-3;Latency-associated peptide;LAP
Species Homo sapiens (Human)
Biological_Activity The ED50 as determined by its ability to inhibit the IL-4-dependent proliferation of TF-1 mouse T?cells is less than 2 ng/ml.
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence ALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYFANFCSGPCPYLRSADTTHSTVLGLYNTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS
Research Area Cancer
Source Mammalian cell
Gene Names TGFB3
Expression Region 301-412aa(Y340F)
Tag Info Tag-Free
Mol. Weight 12.7 kDa
Protein Description Partial
Still Have Questions? Leave a Message or Start an on-line Chat
Function Involved in embryogenesis and cell differentiation.
Involvement in disease Arrhythmogenic right ventricular dysplasia, familial, 1 (ARVD1); Loeys-Dietz syndrome 5 (LDS5)
Subcellular Location Secreted
Protein Families TGF-beta family
Database Links

HGNC: 11769

OMIM: 107970

KEGG: hsa:7043

STRING: 9606.ENSP00000238682

UniGene: Hs.592317

Pathway Hippo signaling pathway
MAPK signaling pathway
TGF-beta signaling pathway
Cell cycle
Cellular senescence
AGE-RAGE signaling pathway in diabetic complications
FoxO signaling pathway

Related Products

TGFB3 Antibodies

TGFB3 Antibodies for Homo sapiens (Human)

TGFB3 Antibodies for Human

TGFB3 Proteins

TGFB3 Proteins for Homo sapiens (Human)

TGFB3 ELISA Kit

TGFB3 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.