Recombinant Human Interferon-gamma(IFNG),partial (Active) (GMP)

In StockGMP
Code CSB-AP005951HU
Product Type Interferon
Size $1441Purchase it in Cusabio online store
(Shop online in the US. Customers outside the US,
please order from local distributors.)
Uniprot No. P01579
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH 5.0, with 3 % Trehalose.
Alias Immune interferon,IFN-gamma
Species Homo sapiens (Human)
Biological_Activity Fully biologically active when compared to standard. The ED50 as measured in anti-viral assays using human HeLa cells infected with encephalomyocarditis (EMC) virus is 0.15-0.80 ng/ml.
Purity > 98 % by SDS-PAGE and HPLC analyses.
Endotoxin Less than 0.01 EU/μg of rHuIFN-γ GMP as determined by LAL method.
Sequence M+QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ
Research Area Immunology
Source E.Coli
Gene Names IFNG
Expression Region 24-166aa
Tag Info Tag-Free
Mol. Weight 16.9 kDa
Protein Description Partial
PubMed ID 6180322; 6173769; 2860101; 6329718; 6176945; 19054851; 15489334; 6427223; 3109913; 2504704; 1902591; 7617032; 10860730; 10986460; 1525157; 15327519
Still Have Questions? Leave a Message or Start an on-line Chat
Function Produced by lymphocytes activated by specific antigens or mitogens. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. It is a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of the type I interferons.
Involvement in disease Aplastic anemia (AA)
Subcellular Location Secreted
Protein Families Type II (or gamma) interferon family
Tissue Specificity Released primarily from activated T lymphocytes.
Database Links

HGNC: 5438

OMIM: 147570

KEGG: hsa:3458

STRING: 9606.ENSP00000229135

UniGene: Hs.856

Pathway HIF-1 signaling pathway
Jak-STAT signaling pathway
TGF-beta signaling pathway
Necroptosis
Antigen processing and presentation
IL-17 signaling pathway
Natural killer cell mediated cytotoxicity
Osteoclast differentiation
T cell receptor signaling pathway
Th1 and Th2 cell differentiation
Th17 cell differentiation

Related Products

IFNG Antibodies

IFNG Antibodies for Human

IFNG Antibodies for Homo sapiens (Human)

IFNG Proteins

IFNG Proteins for Homo sapiens (Human)

IFNG ELISA Kit

IFNG ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.