| Code | CSB-AP003251MO |
| Abbreviation | Recombinant Mouse Il1a protein (Active) |
| MSDS | |
| Size | $354 |
| Order now | |
| Image | |
| Have Questions? | Leave a Message or Start an on-line Chat |
IL-1α is a potent alarmin and upstream driver of NF-κB and MAPK signaling, making precise functional studies critically dependent on cytokine preparations with verified biological potency. This tag-free recombinant mouse IL-1α, encompassing the full mature sequence (residues 115–270), demonstrates an ED50 below 2 pg/mL in murine D10S cell proliferation assays, corresponding to a specific activity exceeding 5.0 × 10⁸ IU/mg — a level that supports use in T-cell activation and differentiation assays, NF-κB/MAPK signaling pathway dissection, and as a reference standard in cytokine detection platforms. Endotoxin levels below 1.0 EU/μg, confirmed by LAL testing, minimize LPS-driven artifacts that commonly confound immune cell functional readouts, making this preparation appropriate for in vivo inflammation models and antibody validation workflows including ELISA and Western blot controls. Purity exceeding 97% by SDS-PAGE, combined with this endotoxin profile, satisfies the quality thresholds commonly required for quantitative dose-response experiments in primary murine immune cells.
There are currently no reviews for this product.
Can this be used for in vivo mouse studies. We want to inject intra-tumorally
SAPYTYQSDLRYKLMKLVRQKFVMNDSLNQTIYQDVDKHYLSTTWLNDLQQEVKFDMYAYSSGGDDSKYPVTLKISDSQLFVSAQGEDQPVLLKELPETPKLITGSETDLIFFWKSINSKNYFTSAAYPELFIATKEQSRVHLARGLPSMTDFQIS