Recombinant Mouse Interleukin-1 alpha protein(Il1a) (Active)


In Stock
Code CSB-AP003251MO
Product Type Interleukin
Size US$112Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. P01582
Lead Time 5-10 business days
Image
Storage Buffer 0.2 μm filtered PBS, pH 7.4 ,lyophilized
Alias IL-1 alpha
Species Mus musculus (Mouse)
Biological_Activity Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine D10S cells is less than 2 pg/ml, corresponding to a specific activity of >5.0x108 IU/mg.
Purity >97% as determined by SDS-PAGE and HPLC.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence SAPYTYQSDL RYKLMKLVRQ KFVMNDSLNQ TIYQDVDKHY LSTTWLNDLQ QEVKFDMYAY SSGGDDSKYP VTLKISDSQL FVSAQGEDQP VLLKELPETP KLITGSETDL IFFWKSINSK NYFTSAAYPE LFIATKEQSR VHLARGLPSM TDFQIS
Research Area Immunology
Source E.coli
Gene Names Il1a
Expression Region 115-270aa
Tag Info Tag-Free
Mol. Weight 17.9 kDa
Protein Description Full Length of Mature Protein
PubMed ID 6209582; 15489334; 3126184
Still Have Questions? Leave a Message or Start an on-line Chat
Function Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.
Subcellular Location Secreted
Protein Families IL-1 family
Database Links

KEGG: mmu:16175

STRING: 10090.ENSMUSP00000028882

UniGene: Mm.15534

Pathway MAPK signaling pathway
Necroptosis
Cellular senescence
Hematopoietic cell lineage
Osteoclast differentiation
AGE-RAGE signaling pathway in diabetic complications

Q&A and Customer Reviews

Q&A
Q:

Can this be used for in vivo mouse studies. We want to inject intra-tumorally

A:
Thanks for your inquiry. Here is the details for your reference.
CSB-AP003251MO Recombinant Mouse Interleukin-1 alpha protein(Il1a)
Expression region: 115-270aa; Full length of mature protein
Tag information: Untagged
Form: Lyophilized powder
Sequence:

SAPYTYQSDLRYKLMKLVRQKFVMNDSLNQTIYQDVDKHYLSTTWLNDLQQEVKFDMYAYSSGGDDSKYPVTLKISDSQLFVSAQGEDQPVLLKELPETPKLITGSETDLIFFWKSINSKNYFTSAAYPELFIATKEQSRVHLARGLPSMTDFQIS


This protein is aseptic processing and endotoxin level is less than 1 EU/µg. It can be used for in vivo mouse studies.
Customer Reviews

Related Products

Il1a Antibodies

Il1a Antibodies for Mus musculus (Mouse)

Il1a Proteins

Il1a Proteins for Mus musculus (Mouse)

Il1a ELISA Kit

Il1a ELISA Kit for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.