Recombinant Mouse Interleukin-1 alpha (Il1a) (Active)

Unavailable
Code CSB-AP004721MO
MSDS
Size $290
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Activity
The ED50 as determined in a cell proliferation assay using mouse D10S cells is less than 20 pg/mL.
Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
Il1aInterleukin-1 alpha; IL-1 alpha
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
115-270aa
Complete Sequence
SAPYTYQSDLRYKLMKLVRQKFVMNDSLNQTIYQDVDKHYLSTTWLNDLQQEVKFDMYAYSSGGDDSKYPVTLKISDSQLFVSAQGEDQPVLLKELPETPKLITGSETDLIFFWKSINSKNYFTSAAYPELFIATKEQSRVHLARGLPSMTDFQIS
Mol. Weight
18 kDa
Protein Length
Full Length of Mature Protein
Tag Info
Tag-Free
Form
Lyophilized powder
Buffer
Lyophilized from a 0.2 μm filtered 50mM Tris-HCl, 200mM NaCl, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The gene fragment encoding the mouse Il1a (115-270aa) was co-cloned into an expression vector and then introduced into E.coli cells for protein expression. The recombinant mouse Il1a was obtained from culture supernatants of transfected E.coli cells and purified using affinity chromatography. Its purity is over 95% as measured by SD-PAGE and its endotoxin content is less than 1.0 EU/μg as determined by the LAL method. This recombinant Il1a protein has been validated to be biologically active, with the ED50 of less than 20 pg/mL as determined in a cell proliferation assay using mouse D10S cells.

Mouse Il1a protein is a cytokine that plays a crucial role in inflammatory responses and immune regulation in mice. Studies have shown that Il1a is involved in various biological processes in mice, such as skin inflammation, oocyte aging, macrophage function, embryo implantation, and regulation of gene expression.

In mouse models of skin inflammation, such as acute skin inflammation induced by PMA, increased Il1a mRNA production is observed, indicating its involvement in inflammatory processes [1]. Il1a has also been implicated in embryo implantation, where it upregulates the expression of certain genes in mouse uterine stromal cells [2]. Il1a and IL6 expression levels are higher in normal and activated mouse blastocysts compared to dormant ones, indicating their involvement in early developmental processes [3].

Furthermore, Il1a deficiency has been shown to increase the expression of follicle-stimulating hormone receptors in granulosa cells, suggesting a role in reproductive processes [4]. Il1a is upregulated in dendritic cells following incubation with immune complexes, indicating its involvement in immune responses [5].

References:
[1] P. Martin, J. Goldstein, L. Mermoud, A. Díaz-Barreiro, & G. Palmer, Il-1 family antagonists in mouse and human skin inflammation, Frontiers in Immunology, vol. 12, 2021. https://doi.org/10.3389/fimmu.2021.652846
[2] A. Fouladi-Nashta, L. Mohamet, J. Heath, & S. Kimber, Interleukin 1 signaling is regulated by leukemia inhibitory factor (lif) and is aberrant in lif−/− mouse uterus1, Biology of Reproduction, vol. 79, no. 1, p. 142-153, 2008. https://doi.org/10.1095/biolreprod.107.065219
[3] J. Shakerzadeh, M. Movahedin, A. Eidi, N. Roodbari, & K. Parivar, Forced suppression of let-7a-5p in mouse blastocysts improves implantation rate, Reproductive Sciences, vol. 29, no. 6, p. 1730-1737, 2021. https://doi.org/10.1007/s43032-021-00659-3
[4] S. Uri-Belapolsky, I. Miller, A. Shaish, M. Levi, D. Harats, L. Ninio-Manyet al., Interleukin 1-alpha deficiency increases the expression of follicle-stimulating hormone receptors in granulosa cells, Molecular Reproduction and Development, vol. 84, no. 6, p. 460-467, 2017. https://doi.org/10.1002/mrd.22799
[5] N. Montfoort, P. Hoen, S. Mangsbo, M. Camps, P. Boross, C. Meliefet al., Fcγ receptor iib strongly regulates fcγ receptor-facilitated t cell activation by dendritic cells, The Journal of Immunology, vol. 189, no. 1, p. 92-101, 2012. https://doi.org/10.4049/jimmunol.1103703

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.
Gene References into Functions
  1. Infection with Mycobacterium bovis results in increase in interleukin-1alpha, TGF-beta1, and MMP1 in multinucleated macrophages. PMID: 29504104
  2. Together, these data suggest that caspase-11/IL-1alpha pathway plays an important role in defending against Klebsiella pneumoniae by recruiting neutrophils in the early stage of infection. PMID: 28939441
  3. These data highlight an important interdependency between the potent pro-inflammatory cytokine IL1A and Fshr expression. PMID: 28337831
  4. Since neither IL-1alpha nor IL-1beta depletions completely rescued the phenotype, we believe that IL-1alpha and IL-1beta have a similar and probably complementary role in FHF progression PMID: 28953903
  5. These results suggested that Streptococcus pneuomoniae PLY induces the influx of calcium in Streptococcus pneumoniae-infected macrophages, followed by calpain activation and subsequent IL-1alpha maturation and secretion. PMID: 28630064
  6. In response to chemically induced colitis, this microbial landscape promoted the release of IL-1alpha, which acted as a critical driver of colitis and colitis-associated cancer. PMID: 27775548
  7. our results suggest that mature IL-1alpha induced by hS100A7 is via RAGE-p38 MAPK and calpain-1 pathway in keratinocyte and this mechanism may play an important role during psoriasis. PMID: 28060905
  8. Il-1 signaling pathway has a key role in abdominal aortic aneurysm formation in mouse model of Kawasaki disease. PMID: 26941015
  9. endothelial cells were identified as the primary cellular source of G-CSF during OPC, which responded to IL-1alpha that was released from keratinocytes in the infected tissue. PMID: 27632536
  10. Key aspects of IL-1alpha biology and regulation especially with regard to inflammation are reviewed. Review. PMID: 27434011
  11. data suggested that pINSd needs IL-1R1 for inflammatory cytokine induction. Mouse embryo fibroblast cells of IL-1R1-deficient mice further confirmed that pINSd promotes immune responses through IL-1R1 PMID: 27226621
  12. IL-1alpha signaling and DNA damage is important for triggering a sterile inflammatory cascade . PMID: 26439902
  13. As a dual function cytokine, IL-1alpha may contribute to the induction of CHOP intracellularly, while IL-1alpha released from necrotic cells accelerates steatohepatitis via induction of inflammatory cytokines by neighboring cells. PMID: 26022690
  14. These data demonstrate that DC and macrophages display distinct patterns of cytokine regulation, particularly with respect to IL-1, as a consequence of cell-type specific differences in the physicochemical properties of the P2X(7)R PMID: 26068648
  15. Data suggest the role of stromal cell IL-1alpha and IL-1beta in Kawasaki disease vasculitis model. PMID: 26515418
  16. IL-1alpha and IL-36alpha form a self-amplifying inflammatory loop in vivo that in patients with insufficient counter regulatory mechanisms may become hyper-engaged and/or chronic PMID: 26203636
  17. IL-1alpha-positive cells were identified in the epithelium in dextran sulfate sodium (DSS)-induced colitis. IL-1alpha was detected in the stool of colitic mice before IL-1beta. PMID: 25864926
  18. IL-1alpha acts as an alarmin essential for leukocyte recruitment and protective immunity against HSV-1 PMID: 25323745
  19. The aim of this study was to characterize the role of IL-1 in cellular responses of carbon nanotubes in cells from IL-1alpha/beta wild type (IL1-WT) mice. PMID: 25748835
  20. These findings do not support the previously suggested role of nuclear IL-1alpha in gene regulation of IL-1beta. PMID: 25748836
  21. the underlying mechanism by which AR influences AAA development is through IL-1alpha and transforming growth factor-beta1, and provides a potential new therapy to suppress/prevent AAA by targeting AR with ASC-J9. PMID: 26324502
  22. inhibition of this potentially important source of chronic inflammation in atherosclerosis requires blockade of interleukin-1alpha and not interleukin-1beta. PMID: 26139463
  23. The frustrated host response to Legionella pneumophila is bypassed by MyD88-dependent translation of pro-inflammatory cytokines. PMID: 25058342
  24. data suggest that central inhibition of IL-1alpha or Tox3 overexpression during the acute phase of a CNS insult may be an effective means for preventing the loss of neurological function PMID: 26224856
  25. Data (including date from studies in knockout mice) suggest that neutralization/deletion of Il1a reduces Il1b production and neutrophil infiltration in lung after inhalation exposure to silica nanoparticles. PMID: 25497724
  26. The controlled release of IL-1alpha could be a critical regulator during acute liver inflammation PMID: 25870999
  27. it appears the balance between TPO and IL-1alpha determines the MK cellular programming for thrombopoiesis in response to acute and chronic platelet needs. PMID: 25963822
  28. In acute lung injury, lipopolysaccharide induced alveolar macrophage necrosis via CD14 and the P2X7 receptor leading to interleukin-1alpha release. PMID: 25862090
  29. IL-1alpha induced the proliferation of CD11b(low) alveolar macrophages and differentiated these cells into CD11b(high) macrophages which perform critical phagocytic functions and organize granuloma. PMID: 25421226
  30. Data indicate that interleukin-1 cytokines IL-1alpha and IL-1beta are regulated by polyubiquitination and proteasomal degradation. PMID: 25371210
  31. IL-1 is a key mediator driving an innate immune response to inflammatory challenge in the mouse brain but is dispensable in extracerebral tissues including the lung and peritoneum. PMID: 25367678
  32. findings identify IL-1alpha as a crucial early danger signal triggering post-MI inflammation. PMID: 25505286
  33. Immune complexes inhibit IL-1 secretion and inflammasome activation. PMID: 25320279
  34. Selective deficiency of IL-1alpha in Kupffer cells reduces liver inflammation and expression of inflammatory cytokines, which may implicate Kupffer cell-derived IL-1alpha in steatohepatitis development. PMID: 24582082
  35. cigarette smoke-induced neutrophilia was dependent on IL-1alpha produced by alveolar macrophages and alveolar macrophages isolated from smoke-exposed mice were primed for excessive IL-1alpha production in response to bacterial ligands. PMID: 25092891
  36. tested the possible role of the proinflammatory cytokine IL-1 in the age-related exhaustion of ovarian reserve using IL-1alpha and IL-1beta-KO mice PMID: 25114230
  37. This study documents distinct roles for IL-1alpha and IL-1beta in the response to Pseudomonas aeruginosa infection as a function of the type 3 secretion system effectors produced by the infecting strain. PMID: 25069982
  38. necroptosis caused the processing and release of IL-1alpha, and this was independent of IL-1beta processing and release PMID: 24790078
  39. IL-1 induces systemic inflammation and augments Streptococcal pneumoniae infection, atherosclerosis, and ischemic brain injury via platelet activation and microvascular coagulation. PMID: 24644058
  40. IL-1alpha was not released upon inflammasome activation unless significant cell damage occurred. PMID: 23684408
  41. haematopoietic-derived IL-1 is a key driver of ischaemic brain injury. PMID: 23519030
  42. In severe S. aureus bacteraemia in mice, TNF-alpha, IL-1alpha, and KC are biomarkers predicting fatal outcome of infection. PMID: 23520553
  43. Our results establish IL-1alpha as a critical initiator of the inflammatory response to L. pneumophila PMID: 23686480
  44. discovery of a novel inflammatory circuit in which RIP1-mediated IL-1alpha secretion in response to deregulated SHP-1 activity triggers an inflammatory destructive disease that proceeds independently of inflammasomes and programmed necrosis PMID: 23708968
  45. Results suggest importance of IL-1R1/IL-1alpha to the recruitment and activation of dendritic cells in response to cigarette smoke exposure. PMID: 22992200
  46. ERalpha-regulated repression of TNFalpha and IL1alpha is important for lumen formation and maintenance. PMID: 22328525
  47. Allergic sensitization to HDM was abolished in vivo when IL-1alpha, GM-CSF, or IL-33 was neutralized. PMID: 22802353
  48. Autophagy has a potentially pivotal role to play in the induction and regulation of inflammatory responses by innate immune cells, largely driven by IL-1 and its consequential effects on IL-23 secretion. PMID: 22972933
  49. Vascular wall resident cells are the main targets for the pro-atherogenic effects of bone marrow-derived IL-1 through IL-1R1, partly by induction of adhesion and chemotactic molecules in endothelial cells. PMID: 22236482
  50. This study demonstrated here in in vivo experiments that IL-1 exacerbates the effects of SCI by accentuating the impact of the inflammatory responses. PMID: 22483094

Show More

Hide All

Subcellular Location
Cytoplasm. Secreted.
Protein Families
IL-1 family
Database Links
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*