Recombinant Mouse Interleukin-4(Il4)

In Stock
Code CSB-AP004831MO
Product Type Interleukin
Size US$137
Uniprot No. P07750
Lead Time 5-10 business days
Storage Buffer Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4
Alias Interleukin-4; IL-4; IL4; B-cell IgG differentiation factor; B-cell growth factor 1; B-cell stimulatory factor 1; BSF-1; IGG1 induction factor; Lymphocyte stimulatory factor 1
Species Mus musculus (Mouse)
Biological_Activity The ED50 as determined in a cell proliferation assay using CTLL?2 mouse cytotoxic T cells is less than 2 ng/ml.
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence HIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS
Research Area Immunology
Source Mammalian cell
Gene Names Il4
Expression Region 21-140aa
Tag Info C-terminal 6xHis-tagged
Mol. Weight 14.6 kDa
Protein Description Full Length of Mature Protein
Still Have Questions? Leave a Message or Start an on-line Chat
Function Participates in at least several B-cell activation processes as well as of other cell types
Subcellular Location Secreted
Protein Families IL-4/IL-13 family
Database Links

KEGG: mmu:16189

STRING: 10090.ENSMUSP00000000889

UniGene: Mm.276360

Pathway Jak-STAT signaling pathway
PI3K-Akt signaling pathway
Fc epsilon RI signaling pathway
Hematopoietic cell lineage
IL-17 signaling pathway
T cell receptor signaling pathway
Th1 and Th2 cell differentiation
Th17 cell differentiation

Related Products

Il4 Proteins

Il4 Proteins for Mus musculus (Mouse)

Il4 ELISA Kit

Il4 ELISA Kit for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.