Home
Active Protein
Other
Recombinant Dog Angiopoietin-2 (ANGPT2) (Active)

Recombinant Dog Angiopoietin-2 (ANGPT2) (Active)

^{In Stock}

Code	CSB-MP001707DO
Abbreviation	Recombinant Dog ANGPT2 protein (Active)
MSDS	MSDS Datasheet
Size	$290
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized Dog ANGPT2 at 2 μg/ml can bind anti-ANGPT2 recombinant antibody (CSB-RA001707MA01HU), the EC₅₀ is 2.836-4.992 ng/mL. Biological Activity Assay
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

≥ 95% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

Measured by its binding ability in a functional ELISA. Immobilized Dog ANGPT2 at 2 μg/mL can bind anti-ANGPT2 recombinant antibody (CSB-RA001707MA01HU), the EC₅₀ is 2.836-4.992 ng/mL.

Target Names

ANGPT2

Uniprot No.

A0A8J8

Alternative Names

(ANG-2)

Molecular Characterization

Species

Canis lupus familiaris (Dog) (Canis familiaris)

Source

Mammalian cell

Expression Region

19-495aa

Target Protein Sequence

YNNFRRSMDSIGRRQYQVQHGSCSYTFLLPETDNCRSPGSYVPNAVQRDAPLDYDDSVQRLQVLENIMENNTQWLIKLENYIQDNMKKEMVEMQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLDMEDKHIVQLRSIKEEKDQLQVLVSKQNSIIEELEKQLVTATVNNSVLQKQQHDLMETVHSLLTMISPSKSPKDTFVAKEEQIIYRDCAEVFKSGLTTNGIYTLTFPNSTEEIKAYCDMETSGGGWTVIQRREDGSVDFQRTWKEYKVGFGNPSGEHWLGNEFVFQVTNQQPYVLKIHLKDWEGNEAYSLYEHFYLSGEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDADNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKGTTMMIRPADF

Mol. Weight

57.2 kDa

Protein Length

Full Length of Mature Protein

Tag Info

C-terminal 6xHis-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Angiopoietin-2 plays a critical role in vascular remodeling and destabilization, making it a key target in cardiovascular and tumor angiogenesis research. This recombinant canine ANGPT2 covers the full mature protein (aa 19–495) and is produced in mammalian cells, preserving native glycosylation patterns essential for proper folding and receptor engagement. Functional ELISA confirms binding potency with an EC50 of 2.836–4.992 ng/mL against an anti-ANGPT2 recombinant antibody, supporting use as a reliable standard in antibody characterization assays, receptor-ligand binding studies, and competition ELISAs. With purity exceeding 95% by SDS-PAGE and endotoxin levels below 1.0 EU/μg, this C-terminal His-tagged protein satisfies the quality criteria typical for in vivo angiogenesis models and cell-based assays investigating endothelial proliferation and survival.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function

Binds to TEK/TIE2, competing for the ANGPT1 binding site, and modulating angiogenic signals mediated by ANGPT1. Can induce tyrosine phosphorylation of TEK/TIE2 in the absence of ANGPT1. In the absence of angiogenic inducers, such as VEGF, ANGPT2-mediated loosening of cell-matrix contacts may induce endothelial cell apoptosis with consequent vascular regression. In concert with VEGF, it may facilitate endothelial cell migration and proliferation, thus serving as a permissive angiogenic signal.

Subcellular Location

Secreted.

Database Links

KEGG: cfa:607616

STRING: 9615.ENSCAFP00000012670

UniGene: Cfa.13296

Promotions