Recombinant Dog Angiopoietin-2 (ANGPT2) (Active)

In Stock
Code CSB-MP001707DO
Size $318
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Dog ANGPT2 at 2 μg/ml can bind anti-ANGPT2 recombinant antibody (CSB-RA001707MA01HU), the EC50 is 2.836-4.992 ng/mL. Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Dog ANGPT2 at 2 μg/mL can bind anti-ANGPT2 recombinant antibody (CSB-RA001707MA01HU), the EC50 is 2.836-4.992 ng/mL.
Target Names
ANGPT2
Uniprot No.
Alternative Names
(ANG-2)
Molecular Characterization
Species
Canis lupus familiaris (Dog) (Canis familiaris)
Source
Mammalian cell
Expression Region
19-495aa
Target Protein Sequence
YNNFRRSMDSIGRRQYQVQHGSCSYTFLLPETDNCRSPGSYVPNAVQRDAPLDYDDSVQRLQVLENIMENNTQWLIKLENYIQDNMKKEMVEMQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLDMEDKHIVQLRSIKEEKDQLQVLVSKQNSIIEELEKQLVTATVNNSVLQKQQHDLMETVHSLLTMISPSKSPKDTFVAKEEQIIYRDCAEVFKSGLTTNGIYTLTFPNSTEEIKAYCDMETSGGGWTVIQRREDGSVDFQRTWKEYKVGFGNPSGEHWLGNEFVFQVTNQQPYVLKIHLKDWEGNEAYSLYEHFYLSGEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDADNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKGTTMMIRPADF
Mol. Weight
57.2 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 6xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

This Recombinant Dog Angiopoietin-2 (ANGPT2) was produced in Mammalian cell, where the gene sequence encoding Dog ANGPT2 (19-495aa) was expressed with the C-terminal 6xHis tag. The purity of this ANGPT2 protein was greater than 95% by SDS-PAGE. The activity was validated by its binding ability in a functional ELISA.

The similarity between dog ANGPT2 and human ANGPT2 is very high, reaching 92.13%. The dog ANGPT2 gene encodes 495 amino acids, the first 18 amino acids are signal peptides, and the mature protein has 477 amino acids. ANGPT2 is mainly secreted by endothelial cells. It is a natural competitive antagonist of ANGPT1. It can competitively inhibit the phosphorylation of ANGPT1 to promote TIE2. ANGPT2 is mainly expressed in vascular endothelial cells and can maintain the dynamic of vascular growth and degeneration by inhibiting the activation of ANGPT1 balance. In addition, the expression of ANGPT2 is regulated by a variety of factors such as VEGF, EGF, bFGF, TNFα, etc. Hypoxia can promote the expression of ANGPT2, However, ANGPT1 and TGF-β down-regulated their expression levels. The effect of ANGPT2 on angiogenesis is related to the local microenvironment. In the presence of VEGF, ANGPT2 can antagonize the effect of ANGPT1 on vascular structure stabilization, which is beneficial to vascular sprouting and growth. When VEGF is lacking, ANGPT2 inhibits ANGPT1, which is beneficial to vascular regression.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Binds to TEK/TIE2, competing for the ANGPT1 binding site, and modulating angiogenic signals mediated by ANGPT1. Can induce tyrosine phosphorylation of TEK/TIE2 in the absence of ANGPT1. In the absence of angiogenic inducers, such as VEGF, ANGPT2-mediated loosening of cell-matrix contacts may induce endothelial cell apoptosis with consequent vascular regression. In concert with VEGF, it may facilitate endothelial cell migration and proliferation, thus serving as a permissive angiogenic signal.
Subcellular Location
Secreted.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 322 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join Us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2023 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*