Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human GLP1R at 2 μg/mL can bind Anti-GLP1R recombinant antibody (CSB-RA009514MA1HU), the EC50 is 54.54-94.23 ng/mL.
Research Area
Cardiovascular
Alternative Names
(GLP-1 receptor)(GLP-1-R)(GLP-1R)
Molecular Characterization
Species
Homo sapiens (Human)
Expression Region
24-145aa
Target Protein Sequence
RPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEEQLLFLY
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
This Human GLP1R recombinant protein was produced in mammalian cell, where the gene sequence encoding Human GLP1R (24-145aa) was expressed with the N-terminal 10xHis tag and C-terminal Myc-tag. The purity of this GLP1R protein was greater than 95% by SDS-PAGE. The activity was validated.
GLP1R is expressed in model organisms and humans and shows a high degree of conservation. It is widely distributed in tissues such as pancreatic islets, stomach, small intestine, heart, kidney, lung and brain in the body. GLP1R is expressed in islet β cells, but its expression in human islet α and δ cells is still controversial. GLP1R belongs to the Gs subclass of G protein-coupled receptors. It is a pleiotropic coupled receptor that regulates cellular pathways mainly by coupling with various G proteins. Studies have shown that GLP1R can be used as an important target for diabetes treatment. However, the molecular mechanism of GLP1R activation needs further research and exploration. The development of GLP1R may promote the development of drug-like molecules, which will also help provide a reference for the development and utilization of the next generation of diabetes drugs, and has very important clinical application value.