Code | CSB-PA831848 |
Size | US$166 |
Order now | |
Image |
|
Have Questions? | Leave a Message or Start an on-line Chat |
Application | Recommended Dilution |
---|---|
ELISA | 1:2000-1:10000 |
IHC | 1:100-1:300 |
There are currently no reviews for this product.
Our group is working with a developmental disease with and expected abnormal Dll4 distribution. Is the CSB-PA831848 DLL4 Antibody compatible with methanol fixation, 4% PFA fixation, or cryosections of mouse samples?
The important information on the CSB-PA831848 DLL4 Antibody is below:
Species reactivity: Human, Mouse
Immunogen: C terminal 135 amino acids of human DLL4
Immunogen sequence:
AVRQLRLRRPDDGSREAMNNLSDFQKDNLIPAAQLKNTNQKKELEVDCGLDKSNCGKQQNHTLDYNLAPGPLGRGTMPGKFPHSDKSLGEKAPLRLHSEKPECRISAICSPRDSMYQSVCLISEERNECVIATEV
The homology between mice and humans is 95.6%, so in theory, this CSB-PA831848 DLL4 Antibody is workable with mouse samples. Because the DLL4 belongs to a membrane protein, it is compatible with 4% PFA fixation. However, we have not validated with cryosections, so we can not guarantee the test results.