Recombinant Dog C-C motif chemokine 17 (CCL17)

^{In Stock}

Code	CSB-EP856825DO
Abbreviation	Recombinant Dog CCL17 protein
MSDS	MSDS Datasheet
Size	$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

CCL17

Uniprot No.

Q95N01

Research Area

Immunology

Alternative Names

CC chemokine TARC;Small-inducible cytokine A17;Thymus and activation-regulated chemokine

Species

Canis familiaris (Dog) (Canis lupus familiaris)

Source

E.coli

Expression Region

24-99aa

Target Protein Sequence

ARGTNVGRECCLEYFKGAIPISRLTRWYKTSGECPKDAIVFVTVQGKSICSDPKDKRVKKAVRYLQRTWKGGPQES
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

23.9 kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-KSI-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Just like other recombinant proteins, the production of this recombinant Dog CCL17 protein began with appropriate cDNA and PCR methods, and then the CCL17 expression plasmids were built. Following sequence determination of the constructs, plasmids were transformed into E.coli for the expression of the recombinant Dog CCL17 protein. N-terminal 6xHis-KSI tag was used in the process. And we finally get the protein of interest with purity of 85%+.

CCL17 is a gene encoding a protein known as C-C motif chemokine 17 (also called CC chemokine TARC, small-inducible cytokine A17 and thymus and activation-regulated chemokine) in dog. It is a chemotactic factor that can bind to CCR chemokine receptor with chemokine activity. The protein encoded by CCL17 gene takes part in multiple biological processes, including cellular response to IFNγ, IL-1 and TNF, chemokine-mediated and G protein-coupled receptor signaling pathway and inflammatory response.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function

Chemotactic factor for t lymphocytes but not monocytes or granulocytes. May play a role in T-cell development in thymus and in trafficking and activation of mature T-cells. Binds to CCR4 and CCR8.

Gene References into Functions

The present results suggest that TNF-alpha-induced CCL17 mRNA transcription in canine keratinocytes is positively regulated by p38 but negatively controlled by ERK. PMID: 20837364
This study suggests that interferon-gamma may suppress granulocyte-macrophage colony stimulating factor production from canine keratinocytes, although further studies are required to confirm this. PMID: 20860556
Inflammatory cytokines are important inducing factors for the production of CCL17 in the lesional skin of dogs with atopic dermatitis. atopic dermatitis. PMID: 20022349

Subcellular Location

Secreted.

Protein Families

Intercrine beta (chemokine CC) family

Tissue Specificity

Expressed in thymus, spleen, lymph node, lung and heart.

Database Links

KEGG: cfa:403586

STRING: 9615.ENSCAFP00000012872

UniGene: Cfa.3450

Promotions