Recombinant Dog Interleukin-8(IL8)

Code CSB-YP011671DO
Product Type Recombinant Protein
Size US$2959
Uniprot No. P41324
Relevance IL-8 is a chotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias C-X-C motif chemokine hemokine (C-X-C motif) ligand 8
Species Canis lupus familiaris (Dog) (Canis familiaris)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence AVLSRVSSELRCQCIKTHSTPFHPKYIKELRVIDSGPHCENSEIIVKLFNGNEVCLDPKEKWVQKVVQIFLKKAEKQDP
Research Area Others
Source Yeast
Gene Names CXCL8
Protein Names Recommended name: Interleukin-8 Short name= IL-8 Alternative name(s): C-X-C motif chemokine 8
Expression Region 23-101aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 11.1kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus.
Subcellular Location Secreted
Protein Families Intercrine alpha (chemokine CxC) family
Database Links

KEGG: cfa:403850

STRING: 9615.ENSCAFP00000004516

UniGene: Cfa.3510

Pathway Chemokine signaling pathway
NF-kappa B signaling pathway
Cellular senescence
IL-17 signaling pathway
NOD-like receptor signaling pathway
Toll-like receptor signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Oxidative Phosphorylation
Phospholipase D signaling pathway

Related Products

CXCL8 Antibodies

CXCL8 Antibodies for Dog

CXCL8 Proteins

CXCL8 Proteins for Canis lupus familiaris (Dog) (Canis familiaris)

CXCL8 ELISA Kit

CXCL8 ELISA Kit for Canis lupus familiaris (Dog) (Canis familiaris)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.