Recombinant Dog Interleukin-8(IL8)

Product Type Recombinant Protein
Uniprot No. P41324
Species Canis lupus familiaris (Dog) (Canis familiaris)
Research Area Others
Gene Names CXCL8
Protein Names Recommended name: Interleukin-8 Short name= IL-8Alternative name(s): C-X-C motif chemokine 8
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Target Details This protein is a member of the CXC chemokine family. This chemokine is one of the major mediators of the inflammatory response. This chemokine is secreted by several cell types. It functions as a chemoattractant, and is also a potent angiogenic factor. This gene is believed to play a role in the pathogenesis of bronchiolitis, a common respiratory tract disease caused by viral infection. This gene and other ten members of the CXC chemokine gene family form a chemokine gene cluster in a region mapped to chromosome 4q.
Function IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus.
Subcellular Location Secreted
Protein Families Intercrine alpha (chemokine CxC) family
Database Links

KEGG: cfa:403850

STRING: 9615.ENSCAFP00000004516

UniGene: Cfa.3510

Pathway Chemokine signaling pathway
NF-kappa B signaling pathway
Cellular senescence
IL-17 signaling pathway
NOD-like receptor signaling pathway
Toll-like receptor signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Oxidative Phosphorylation
Phospholipase D signaling pathway

Product Details for Different Expression Systems

Product Name Recombinant Dog Interleukin-8(IL8),Baculovirus
Code CSB-BP011671DO
Size Pls inquiry other sizes
Source Baculovirus
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence AVLSRVSSELRCQCIKTHSTPFHPKYIKELRVIDSGPHCENSEIIVKLFNGNEVCLDPKEKWVQKVVQIFLKKAEKQDP
Expression Region 23-101aa
Protein Description Full Length of Mature Protein
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Still Have Questions? Leave a Message or Start an on-line Chat

Related Products

CXCL8 Antibodies

CXCL8 Antibodies for Dog

CXCL8 Proteins

CXCL8 Proteins for Canis lupus familiaris (Dog) (Canis familiaris)

CXCL8 ELISA Kit

CXCL8 ELISA Kit for Canis lupus familiaris (Dog) (Canis familiaris)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.