Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
26 kDa cell surface protein TAPA 1; 26 kDa cell surface protein TAPA-1; 26 kDa cell surface protein TAPA1; CD 81; CD81; CD81 antigen (target of antiproliferative 1); CD81 antigen; CD81 molecule; CD81_HUMAN; CVID6; S5.7; TAPA 1; TAPA1; Target of the antiproliferative 1; Tetraspanin 28; Tetraspanin-28; Tetraspanin28; Tspan 28; Tspan-28; Tspan28
Species
Homo sapiens (Human)
Expression Region
113-201aa
Target Protein Sequence
FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGK
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Extracellular Domain
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Enhance your research in immunology with our Recombinant Human CD81 protein, a partial protein derived from the 113-201aa expression region. This protein, also known as CD81 antigen, 26 kDa cell surface protein TAPA-1, Target of the antiproliferative antibody 1, and Tetraspanin-28, originates from human sources and is produced using yeast expression systems.
Featuring an N-terminal 6xHis tag, our Recombinant Human CD81 protein allows for efficient purification and easy detection during your experiments. The lyophilized powder form ensures stability and quality, while the protein's purity of greater than 90% as determined by SDS-PAGE guarantees a reliable and robust product for your research needs.