| Code | CSB-EP002740HU |
| Abbreviation | Recombinant Human BMP4 protein |
| MSDS | |
| Size | $224 |
| Order now | |
| Image | |
| Have Questions? | Leave a Message or Start an on-line Chat |
There are currently no reviews for this product.
Could you send a price to me for the following below. These will be used on the Biocore so if you can recommend a good purity version, that would be great.
500ug of Human BMP4
SPKHHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR