Recombinant Human Bone morphogenetic protein 4(BMP4)

In Stock
Code CSB-EP002740HU
Product Type Recombinant Protein
Size US$162
Uniprot No. P12644
Lead Time 3-7 business days
Relevance Induces cartilage and bone formation. Also act in mesoderm induction, tooth development, limb formation and fracture repair. Acts in concert with PTHLH/PTHRP to stimulate ductal outgrowth during bryonic mammary development and to inhibit hair follicle induction .
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Bone morphogenetic protein 2B ;BMP-2B
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence SPKHHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR
Research Area Developmental Biology
Source E.coli
Gene Names BMP4
Expression Region 293-408aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 29.1kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Induces cartilage and bone formation. Also act in mesoderm induction, tooth development, limb formation and fracture repair. Acts in concert with PTHLH/PTHRP to stimulate ductal outgrowth during embryonic mammary development and to inhibit hair follicle induction (By similarity).
Involvement in disease Microphthalmia, syndromic, 6 (MCOPS6); Non-syndromic orofacial cleft 11 (OFC11)
Subcellular Location Secreted, extracellular space, extracellular matrix
Protein Families TGF-beta family
Tissue Specificity Expressed in the lung and lower levels seen in the kidney. Present also in normal and neoplastic prostate tissues, and prostate cancer cell lines.
Database Links

HGNC: 1071

OMIM: 112262

KEGG: hsa:652

STRING: 9606.ENSP00000245451

UniGene: Hs.68879

Pathway Hippo signaling pathway
TGF-beta signaling pathway
Signaling pathways regulating pluripotency of stem cells

Related Products

BMP4 Antibodies

BMP4 Antibodies for Human

BMP4 Antibodies for Homo sapiens (Human)

BMP4 Proteins

BMP4 Proteins for Homo sapiens (Human)

BMP4 ELISA Kit

BMP4 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.