Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
Code | CSB-EP002740HU |
Abbreviation | Recombinant Human BMP4 protein |
MSDS | |
Size | $224 |
Order now | |
Image | |
Have Questions? | Leave a Message or Start an on-line Chat |
There are currently no reviews for this product.
Could you send a price to me for the following below. These will be used on the Biocore so if you can recommend a good purity version, that would be great.
500ug of Human BMP4
SPKHHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR