Recombinant Human C-C chemokine receptor type 2 (CCR2), partial

Code CSB-YP004841HU1
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP004841HU1
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP004841HU1-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP004841HU1
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP004841HU1
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
CCR2
Uniprot No.
Alternative Names
CCR2; CMKBR2; C-C chemokine receptor type 2; C-C CKR-2; CC-CKR-2; CCR-2; CCR2; Monocyte chemoattractant protein 1 receptor; MCP-1-R; CD antigen CD192
Species
Homo sapiens (Human)
Expression Region
310-374
Target Protein Sequence
EKFRSLFHIALGCRIAPLQKPVCGGPGVRPGKNVKVTTQGLLDGRGKGKSIGRAPEASLQ DKEGA
Protein Length
Partial
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Key functional receptor for CCL2 but can also bind CCL7 and CCL12. Its binding with CCL2 on monocytes and macrophages mediates chemotaxis and migration induction through the activation of the PI3K cascade, the small G protein Rac and lamellipodium protrusion (Probable). Also acts as a receptor for the beta-defensin DEFB106A/DEFB106B. Regulates the expression of T-cell inflammatory cytokines and T-cell differentiation, promoting the differentiation of T-cells into T-helper 17 cells (Th17) during inflammation. Facilitates the export of mature thymocytes by enhancing directional movement of thymocytes to sphingosine-1-phosphate stimulation and up-regulation of S1P1R expression; signals through the JAK-STAT pathway to regulate FOXO1 activity leading to an increased expression of S1P1R. Plays an important role in mediating peripheral nerve injury-induced neuropathic pain. Increases NMDA-mediated synaptic transmission in both dopamine D1 and D2 receptor-containing neurons, which may be caused by MAPK/ERK-dependent phosphorylation of GRIN2B/NMDAR2B. Mediates the recruitment of macrophages and monocytes to the injury site following brain injury.; (Microbial infection) Alternative coreceptor with CD4 for HIV-1 infection.
Gene References into Functions
  1. miR-135a-3p serves as a tumour suppressor gene in ovarian cancer by regulating CCR2. PMID: 30138893
  2. this study shows that CCR2 is upregulated on peripheral T cells in osteoarthritis PMID: 30403025
  3. The A allele of CCR2 rs1799864 was associated with a higher MCP-1 level in AD and MCI patients. PMID: 29352259
  4. Study results revealed that CCR2 promotes epithelialtomesenchymal transition through MMP2 in liver cancer. PMID: 30132565
  5. NOX4 is induced in early alcoholic liver injury and regulates CCR2/CCL2 mRNA stability thereby promoting recruitment of inflammatory cells and production of proinflammatory cytokines. PMID: 28383062
  6. T cell-stimulated CLL cells actively recruited monocytes; recruitment critically depended on the C-C-motif-chemokine-receptor-2 axis. PMID: 28971904
  7. Study found that the activation of CCR2 by its ligand CCL2 increased the expression of SMO and Gli-1, resulting in Hh pathway activation, epithelial-mesenchymal transition and hepatocellular carcinoma cell invasion. PMID: 29115520
  8. results confirmed that the CCR2 3'UTR acts as a metastasis suppressor by acting as a ceRNA for STARD13 and thus inhibiting RhoA-ROCK1-MLC-F-actin pathway in breast cancer cells. PMID: 28818997
  9. It can be concluded that MCP-1 and CCR2 polymorphisms are not associated with AgP in Turkish population. PMID: 28458180
  10. beta-arrestin2/AP-1-dependent beta2AR signaling has a critical role in the regulation of CCR2 expression and recruitment of leukocytes to the heart following injury PMID: 27956622
  11. Results indicated that MCP-1 and CCR2 polymorphisms may influence the progression of IgAN, but not increase/decrease its susceptibility PMID: 27788494
  12. High CCR2 expression is associated gastric cancer. PMID: 26992207
  13. Our data strongly support the use of CCR2 and CD180 mRNAs as whole blood pharmacodynamic (PD)biomarkers for BRD4 inhibitors, especially in situations where paired tumor biopsies are unavailable. In addition, they can be used as tumor-based PD biomarkers for hematologic tumors. PMID: 28073847
  14. Through experiments with chimeras of MCP-1 and MCP-3, we identified the chemokine amino-terminal region as being the primary determinant of both the binding and signaling selectivity of these two chemokines at CCR2. PMID: 28536301
  15. Comprehensive Computational Analysis of GWAS Loci Identifies CCR2 as a Candidate Gene for Celiac Disease Pathogenesis PMID: 28059456
  16. Studies indicate manipulating CCL2-CCR2 interaction as a potential approach for combating metastatic disease. PMID: 26885690
  17. Interruption of either CCL2-CCR2 signaling or cathepsin B function significantly impaired perineural invasion (PNI). PMID: 28951461
  18. No statistically significant correlation was found between CRC and the 190 G/A CCR2 polymorphism with colorectal cancer prevalence PMID: 29154245
  19. rs1799864 polymorphism significantly associated with occurrence risk of psoriasis vulgaris in Chinese population PMID: 29145242
  20. CCR2 genetic variants were not associated with risk of atherosclerotic coronary heart disease and glucometabolic traits. PMID: 27013693
  21. These data suggest that CCR1/CCR2B could be involved in clearing EBV-infected latency III B cells in immunocompetent individuals via directing the migration of these cells and attracting the chemokines-expressing immune cells. PMID: 28892735
  22. systemic mRNA expression of CCR2 strongly differentiated children who failed to achieve asthma control with triamcinolone administration PMID: 27665382
  23. Basophil migration into skin lesions of Systemic Lupus Erythematosus patients were observed, but not in normal skin tissue. This migration was related to the upregulation of chemokine receptors CCR1 and CCR2 on basophils. PMID: 28954264
  24. The CCR2 (+190 G/A) GG genotype frequencies for patients were significantly higher in the stage III-IV cancer group ( p = 0.036), and A allele carriers were significantly higher in the stage I-II ovarian cancer group. PMID: 28650671
  25. tumor-promoting role for CCL2 acting through CCR2 on the tumor microenvironment PMID: 27820834
  26. The findings of the work indicate a role for Galphaq and/or Galpha14 and in CCR2a/CCR2b-stimulated Rho A GTPase-mediated serum response factor activation. PMID: 26823487
  27. Endogenous TRAIL/TRAIL-R-mediated CCL2 secretion promotes accumulation of tumor-supportive immune cells in the cancer microenvironment. PMID: 28212753
  28. CCL2/CCR2 axis is expressed in the majority of monocytoid Acute myeloid leukemia blasts PMID: 28045930
  29. CCR2B and beta2AR signals to FLNa to stimulate its endocytosis and recycling to the plasma membrane. PMID: 27909248
  30. this study shows that CYTL1 possesses chemotactic activity and demonstrates that its functional receptor is CCR2B PMID: 27084102
  31. PCSK9 regulates monocyte CCR2 expression and chemotaxis. PMID: 28232185
  32. CCR2-targeted therapy with PF-04136309 in combination with FOLFIRINOX is safe and tolerable PMID: 27055731
  33. Binding of J113863 to CCR2 or CCR5 also induced the recruitment of beta-arrestin 2, whereas UCB35625 did not. UCB35625 induced the chemotaxis of L1.2 cells expressing CCR2 or CCR5. In contrast, J113863 induced the migration of L1.2-CCR2 cells but antagonized the chemokine-induced migration of L1.2-CCR5 cells. PMID: 27895119
  34. CCL2 suppressed HDL internalization and cholesterol efflux via CCR2 induction and p42/44 MAPK activation in ECs. CCL2 induction may contribute to impair HDL function and form atherosclerosis in coronary artery disease. PMID: 27458015
  35. High levels of TRAIL-R3 and CCR-2 expression in tumor epithelial cells identified patients with early breast cancer with poor outcomes. PMID: 28420351
  36. X ray crystal structure of CC chemokine receptor 2 with orthosteric and allosteric antagonists PMID: 27926736
  37. Ingestion of an amino acid supplement immediately post-exercise appears to help maintain plasma MCP-1 concentrations and augment CCR2 expression in resistance trained men. PMID: 27384580
  38. HUMSCs expressing ISZ-sTRAIL might be an efficient therapeutic approach against lung cancer and MCP-1/CCR2 axis is essential for the tumor tropism of HUMSCs PMID: 26733169
  39. The authors demonstrate a positive correlation between CCR2 receptor gene polymorphism and a subgroup of breast cancer showing poor prognosis, which deserves further investigation in larger samples for validation. PMID: 25716470
  40. Results of this study indicated that the CCL2-CCR2 axis was involved in the pathogenesis of oral lichen planus and was positively correlated with disease activity. PMID: 25893607
  41. sCCL2 production possibly will be associated with the adiposity and polymorphic phenotypes of CCL2 and CCR2, in Mexican-Mestizos with insulin resistance PMID: 26839895
  42. Increased CCR2 expression is associated with bladder cancer metastasis. PMID: 26556868
  43. These findings suggested that the CCL2/CCR2 chemokine signaling may regulate the epithelial-mesenchymal transition. PMID: 26648448
  44. CCR2 gene polymorphism (64I allele carriage) is a predisposing factor for allergy. PMID: 27534043
  45. data suggest that the CCR2-64I polymorphism is associated with the protective effect to development of cervical lesions as well as in the protection to HPV 16 infection. PMID: 26982176
  46. Ovarian cancer cells express both Hp and its receptor CCR2 but only after exposure to ascitic fluid, inducing moderated cell migration; results suggest that Hp-induced changes in the cell morphology, actin cytoskeleton structure, and migration ability of tumor cells, is possibly "preparing" these cells for the potential induction of the metastatic phenotype. PMID: 26211665
  47. The frequencies of the rare alleles of CCR2, ITGB3, and 3'UTR of c-fms in the Old Believers are lower than in the sample of Novosibirsk Russians, and the rare allele of DBH is more frequent PMID: 27239844
  48. Among HIV-seropositive samples 3.4% were homozygous CCR2-64I mutants, 17.8%) were heterozygous,78.8% were CCR2 wild type. PMID: 26300579
  49. results suggest that senescent dermal fibroblasts recruit stem cells by secreting various factors and that the CCL2/CCR2 axis is one of the mechanisms underlying this phenomenon PMID: 25808810
  50. Association of hydrogen sulfide with alterations of monocyte chemokine receptors, CCR2 and CX3CR1 in patients with coronary artery disease PMID: 26123579

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Expressed by monocytes and IL2-activated NK cells.
Database Links

HGNC: 1603

OMIM: 601267

KEGG: hsa:729230

STRING: 9606.ENSP00000292301

UniGene: Hs.511794

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1