Recombinant Human Claudin-3 (CLDN3), partial

Code CSB-YP005505HU1
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP005505HU1
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP005505HU1-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP005505HU1
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP005505HU1
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥85% (SDS-PAGE)
Target Names
Uniprot No.
Alternative Names
CLDN3; C7orf1; CPETR2; Claudin-3; Clostridium perfringens enterotoxin receptor 2; CPE-R 2; CPE-receptor 2; Rat ventral prostate.1 protein homolog; hRVP1
Species
Homo sapiens (Human)
Expression Region
30-80
Target Protein Sequence
RVSAFIGSNIITSQNIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAAR
Protein Length
partial
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.
Gene References into Functions
  1. Claudin3 promoter methylation status (HR: 5.67; 95% CI: 2.2714.17) but not claudin3 expression was an independent predictor of survival. Claudin3 promoter hypermethylation reduces claudin3 expression and independently predicts poor prognosis. PMID: 29749528
  2. Immunohistochemical expression levels of cytoplasmic claudins 3 and 7 appear to be novel prognostic factors in triple-negative breast cancer. PMID: 29482498
  3. CLDN3 could be further evaluated as a novel biomarker for predicting the prognosis of lung squamous cell carcinoma (SqCC) and as a target for the treatment of lung SqCC in the future. PMID: 29511369
  4. We describe a novel workflow, completely covering the analysis of CLDN3 as an exemplary exosome-based biomarker for prostate cancer from in vitro profiling of cancer exosomes over in silico identification and in vitro retesting to clinical validation. PMID: 28396511
  5. Data indicate that CDH11, ICAM1 and CLDN3 were overexpressed in tumors when compared to normal esophagus, normal gastric and non-dysplastic Barrett's. PMID: 27363029
  6. Study provide first biochemically and clinically validated evidence to support a colorectal cancer-suppressive function of claudin-3 by serving as a conjoint rheostat for regulating Stat-3 and Wnt/beta-catenin-signaling. PMID: 28783170
  7. These tumor samples express CD44 protein at low rather than high levels. There is no correlation between CLDN3 gene expression and protein expression in these CPTAC samples; hence, the claudin-low subtype defined by gene expression is not the same group of tumors as that defined by low expression of CLDN3 protein. PMID: 28287265
  8. Increased expression of intestinal epithelial claudin-1 with downregulation of claudin-3 has been observed in intestinal inflammatory disorders. PMID: 28493289
  9. Data show that the charge of Lys65 in claudin 1 (Cldn1) and Glu158 in claudin 3 (Cldn3), and of Gln57 in claudin 5 (Cldn5) are necessary for tight junction (TJ) strand formation. PMID: 28415153
  10. Mislocalization claudin-3 to nucleus in colon cancer and mislocalization claudin-4 to nucleus in adenomas of the colon were detected for the first time. . PMID: 28295005
  11. Intracellular zinc has an essential role in the maintenance of the intestinal epithelial tight junction barrier through regulation of occludin proteolysis and claudin-3 transcription. PMID: 27151944
  12. permeability barriers and affected cell morphology, proliferation, migration, AKT signaling, and gene expression. When claudins are exogenously expressed, ARPE-19 more closely model native RPE. PMID: 27593915
  13. localization of Cldn3, Cldn7 and Cldn10 proteins in the different compartments of murine endometrium up to day 8.5 of pregnancy (dpc) as well as in human endometrium and first trimester decidua PMID: 26340953
  14. Cln-3 plays a vital role in TNF-modulated paracellular permeability in submandibular epithelium. PMID: 26148935
  15. Further in vitro studies suggested that the isolated MAbs possessed the desired binding properties for the detection or targeting of CLDN3. PMID: 25744656
  16. that Claudin-3 expression was restricted to the apical pole of ependymocytes in the subcommissural organ PMID: 24974365
  17. The expressions of MARVELD2, CLDN1 and CLDN3 mRNA were significantly lower in cholesteatoma tissue and may be involved in epithelium permeability. PMID: 25319490
  18. Univariate analyses indicated that the T stage, lymph node metastasis, the TNM stage, and the expression of claudin-3, beta-catenin, and vimentin were significant predictors for overall survival (OS). PMID: 25820701
  19. Data from live-cell imaging suggest at least two different cis-interaction interfaces within CLDN3 homopolymers as well as within CLDN1/CLDN3 heteropolymers. PMID: 25849148
  20. our findings demonstrated that CLDN3 is an epigenetically silenced metastasis suppressor gene in Hepatocellular carcinoma PMID: 25277196
  21. Study highlights a profound role for the choroid plexus in the pathogenesis of multiple sclerosis, and implies that CLDN3 may be regarded as a crucial and novel determinant of blood-cerebrospinal fluid barrier integrity PMID: 24356983
  22. Claudin 3 was expressed in all non-goblet columnar lined oesophagus, Barrett's oesophagus, high grade dysplasia and adenocarcinoma. PMID: 24290871
  23. Claudin-3 overexpression increases the malignant potential of colorectal cancer cells. PMID: 24069372
  24. folding and assembly of CLDN3 and CLDN5 into the tight junction are controlled by non-conserved residues in the transmembrane 3 and extracellular loop 2 segments PMID: 24478310
  25. Our comparative analysis of CLDN3 profile in breast and ovarian cancer clearly indicates organ specificity. PMID: 23529315
  26. Snail and Claudin-3 may play important roles in invasion and metastasis in NSCLC PMID: 23075682
  27. Claudin-3 expression in uterine luminal epithelium is stimulated by progesterone and suppressed by heparin-binding epidermal growth factor-like growth factor. PMID: 23909989
  28. High CLDN3 expression is associated with tumor growth and metastases. PMID: 23097631
  29. Dow-regulation of Claudin-3 is associated with the progression of early gastric adenocarcinomas. PMID: 22290341
  30. CLDN3 may have a role in ovarian cancer, and its inhibition by short hairpin RNA could be a treatment strategy. PMID: 21519794
  31. Analysis of staining intensities of CLDN 1 and 3 is useful as an auxiliary diagnostic and prognostic tool in patients with salivary gland mucoepidermoid carcinoma. PMID: 21184237
  32. demonstrate that claudin-3 alters the tight junction meshwork and seals the paracellular pathway against the passage of small ions of either charge and uncharged solutes PMID: 20655293
  33. Claudin-3 expression in Epstein-Barr virus-associated nasopharyngeal carcinoma was variable PMID: 20204275
  34. Increased expressions of CLDN 2 and 3 suggest structural changes of tight junction in coeliac disease which may be, at least in part, responsible for increased permeability and proliferation observed in coeliac disease. PMID: 20143085
  35. Here we show for the first time in both an experimental and clinical setting a strong relation between intestinal tight junction loss and urinary claudin-3 levels PMID: 19525861
  36. Airway tight junctions are regulated by claudin interactions that confer the selectivity of the junction. PMID: 12909588
  37. up-regulation of DDR1, CLDN3, and epithelial cell adhesion molecule are early events in the development of epithelial ovarian cancer PMID: 15240533
  38. in breast tissue, CLDN3 expression is similar in tumours and surrounding normal tissue, as demonstrated by immunohistochemistry and real-time PCR PMID: 15743508
  39. claudin-3 phosphorylation by PKA may provide a mechanism for the disruption of tight junctions in ovarian cancer PMID: 15905176
  40. The gene expression profile of hepatic stem cells throughout life consists of high levels of expression of claudin-3 (CLDN-3). PMID: 16627685
  41. Claudin tight junction proteins in endoscopy biopsy samples showed Barrett's metaplasia contains more claudin-2 and claudin-3 than found in normal esophageal mucosa, but markedly lower claudins 1 and 5, indicating very different tight junction barriers. PMID: 17103306
  42. Overexpression of claudin-3 is associated with uterine serous papillary carcinoma PMID: 17326053
  43. When compared, small-cell-lung cancers, carcinoid tumors, and adenocarcinomas revealed significant differences re: CLDN3 expression. PMID: 17418912
  44. CLDN3 overexpression can be used as a prognostic indicator in ovarian serous carcinomas and it may be a promising target for antibody-based therapy of ovarian carcinomas. PMID: 17647191
  45. siRNA-mediated knockdown of Sp1 led to a significant decrease of CLDN3 expression at both the mRNA and protein levels, demonstrating a crucial role for this transcription factor in the regulation of CLDN3. PMID: 17986852
  46. Claudin-3 and claudin-7 expression in effusions independently predicts poor survival in ovarian cancer. PMID: 18439941
  47. claudins 1 and 3 had a significant effect on overall survival in patients with urothelial carcinoma of the upper urinary tract. PMID: 18550469
  48. This is the first study to demonstrate that claudin-3 is involved in the barrier function of gastric epithelial cells and that rebamipide abolishes the H2O2-induced decrease in claudin-3 protein. PMID: 18774778
  49. For the first time this study proves the presence of Claudin-1, Claudin-3 and Claudin-5 in ECV304 (obtained from ECACC) cell layers and the inducibility of their expression by glioma-conditioned media. PMID: 18817843
  50. Using a panel of four genes (AHRR, p16INK4a, MT1G, and CLDN3) resulted in sensitivity and specificity of 50% and 68%, respectively and may have utility for early detection of esophageal squamous dysplasia and early ESCC. PMID: 19137073

Show More

Hide All

Involvement in disease
CLDN3 is located in the Williams-Beuren syndrome (WBS) critical region. WBS results from a hemizygous deletion of several genes on chromosome 7q11.23, thought to arise as a consequence of unequal crossing over between highly homologous low-copy repeat sequences flanking the deleted region.
Subcellular Location
Cell junction, tight junction. Cell membrane; Multi-pass membrane protein.
Protein Families
Claudin family
Database Links

HGNC: 2045

OMIM: 602910

KEGG: hsa:1365

STRING: 9606.ENSP00000378577

UniGene: Hs.647023

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1