Recombinant Human Claudin-3(CLDN3),partial

In Stock
Code CSB-EP005505HU1a6
Product Type Recombinant Protein
Size US$2062Purchase it in Cusabio online store
(Shop online in the US. Customers outside the US,
please order from local distributors.)
Uniprot No. O15551
Lead Time 3-7 business days
Relevance Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Clostridium perfringens enterotoxin receptor 2
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence RVSAFIGSNIITSQNIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAAR
Research Area Signal Transduction
Source E.coli
Gene Names CLDN3
Expression Region 30-80aa
Tag Info N-terminal 6xHis-B2M-tagged
Mol. Weight 19.7kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.
Involvement in disease CLDN3 is located in the Williams-Beuren syndrome (WBS) critical region. WBS results from a hemizygous deletion of several genes on chromosome 7q11.23, thought to arise as a consequence of unequal crossing over between highly homologous low-copy repeat sequences flanking the deleted region.
Subcellular Location Cell junction, tight junction, Cell membrane, Multi-pass membrane protein
Protein Families Claudin family
Database Links

HGNC: 2045

OMIM: 602910

KEGG: hsa:1365

STRING: 9606.ENSP00000378577

UniGene: Hs.647023

Related Products

CLDN3 Antibodies

CLDN3 Antibodies for Homo sapiens (Human)

CLDN3 Antibodies for Human

CLDN3 Proteins

CLDN3 Proteins for Homo sapiens (Human)

CLDN3 ELISA Kit

CLDN3 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.