Name: Recombinant Human Claudin-3 (CLDN3), partial
Brand: CUSABIO
SKU: CSB-EP005505HU1a6

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

CLDN3

Uniprot No.

O15551

Research Area

Signal Transduction

Alternative Names

CLDN3; C7orf1; CPETR2; Claudin-3; Clostridium perfringens enterotoxin receptor 2; CPE-R 2; CPE-receptor 2; Rat ventral prostate.1 protein homolog; hRVP1

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

30-80aa

Target Protein Sequence

RVSAFIGSNIITSQNIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAAR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

19.7kDa

Protein Length

Partial

Tag Info

N-terminal 6xHis-B2M-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

This Recombinant Human Claudin-3 (CLDN3) is a specialized research reagent tailored for signal transduction investigations, providing a focused and cost-effective tool for dissecting the functional roles of human CLDN3. Produced in E. coli, this partial protein spans amino acids 30–80 aa of the human CLDN3, with a molecular weight of about 20 kDa and an N-terminal 6xHis-B2M tag to streamline purification and downstream detection. A key advantage of this product is its high purity—greater than 90% as confirmed by discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel—ensuring experimental accuracy and minimizing non-specific background noise. The partial nature of the protein, targeting a specific functional domain, allows for more targeted experimental design, such as epitope mapping or antibody generation, while the dual-tag system simplifies purification workflows compared to many conventional recombinant proteins. This recombinant CLDN3 protein is optimized for human research, offering scientists a reliable, high-purity tool to advance their understanding of CLDN3-mediated signaling pathways with enhanced experimental control and cost-efficiency.

Customer Reviews and Q&A

■ Customer Reviews

Average Rating:

5.0 - 1 reviews

Submit a Review here

Applications : /

Review: Recombinant claudin3 (Cusabio, Wuhan, China) was labeled with HRP and used as tracer.

By Anonymous

Code	CSB-EP005505HU1a6
Abbreviation	Recombinant Human CLDN3 protein, partial
MSDS	MSDS Datasheet
Size	US$256
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Claudin-3 (CLDN3), partial

Product Details

Citations

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage