Product Details

Purity

Greater than 95% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

①Measured by its binding ability in a functional ELISA. Immobilized Human CD69 at 2 μg/mL can bind Anti-CD69 recombinant antibody (CSB-RA004952MA1HU), the EC50 is 23.17-26.04 ng/mL.

Target Names

CD69

Uniprot No.

Q07108

Alternative Names

(Activation inducer molecule)(BL-AC/P26)(C-type lectin domain family 2 member C)(EA1)(Early T-cell activation antigen p60)

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

62-199aa

Target Protein Sequence

SVGQYNCPGQYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKRYAGREEHWVGLKKEPGHPWKWSNGKEFNNWFNVTGSDKCVFLKNTEVSSMECEKNLYWICNKPYK

Mol. Weight

18.7 kDa

Protein Length

Extracellular Domain

Tag Info

C-terminal 10xHis-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Datasheet & COA

Please contact us to get it.

Description

This Human CD96 recombinant protein was produced in Mammalian cell, where the gene sequence encoding Human CD96 (62-199aa) was expressed with the C-terminal 10xHis tag. The purity of this CD96 protein was more than 95%. Its endotoxin content is less than 1.0 EU/ug as determined by the LAL method. The activity was validated. In a functional ELISA, immobilized human CD69 at 2 μg/mL can bind Anti-CD69 recombinant antibody (CSB-RA004952MA1HU) with the EC₅₀ of 23.17-26.04 ng/mL.

CD69 was discovered in 1981. It was also known as an activation-inducing molecule (AIM), Leu23 and MLR-3 in the early stage. It is the earliest expressed membrane surface molecule for lymphocyte activation and is usually used as a marker of T cell activation in many studies. CD69 is a pleiotropic immune regulatory molecule that plays an important role in the activation and differentiation of various hematopoietic cells. Since CD69 was discovered, its initial research is basically about its role in cell activation. Early research mainly focused on its expression in T cells and NK cells. The mechanism of inducing CD69 expression is mainly the activation of PKC and the activation of cells. The continuous increase of internal Ca²⁺ level, blocking the PKC pathway can directly inhibit the expression of CD69. The rapid expression of CD69 in activated cells is not only a marker molecule, in fact, its more important role is to further enhance cell activation or proliferation and differentiation as a cell costimulatory signal. CD69 is not expressed in the quiescent state of T cells and NK cells, but expresses rapidly after cell activation, indicating that CD69 has an important regulatory effect on the immune system, so CD69 can be used as a therapeutic agent for blood system diseases and immune-related diseases potential therapeutic target. However, at present, there are few clinical drug studies on CD69 and the progress is slow. The development of CD69 active protein can help CD69 clinical drug development and testing.

Target Background

Function

Involved in lymphocyte proliferation and functions as a signal transmitting receptor in lymphocytes, natural killer (NK) cells, and platelets.

Gene References into Functions

CD69 is a direct target of miR-367-3p. PMID: 30015935
The frequency of CD69+ T cells was significantly higher in CD8+ and CD4+ T cells in nasal polyps compared with the peripheral blood of patients with chronic rhinosinusitis. PMID: 29749428
this paper shows that decrease of CD69 levels on TCR Valpha7.2(+)CD4(+) innate-like lymphocytes is associated with impaired cytotoxic functions in chronic hepatitis B virus-infected patients PMID: 28606013
AIM expression in the kidney was associated with urinary protein and decline in kidney function. PMID: 26846784
Higher CD69 expression were less sensitive to bendamustine and is associated with chronic lymphocytic leukemia. PMID: 26701728
In vitro functional assays showed that CD69(+) Treg cells exerted an important suppressive effect on the activation of T effector cells PMID: 26100786
results demonstrate the functional and mechanistic interplays between CD69 and S100A8/S100A9 in supporting Treg-cell differentiation PMID: 26296369
Elevated expression of CD69 and CD161 on NK cells can be considered as immunological risk markers in RSA and IVF failure. PMID: 24975965
these findings identify CD69 and galectin-1 to be a novel regulatory receptor-ligand pair that modulates Th17 effector cell differentiation and function. PMID: 24752896
REVIEW: CD69 exerts a complex immunoregulatory role in humans, and that it could be considered as a target molecule for the therapy of immune-mediated diseases PMID: 23954168
Following coculture with GTKO/CD46 pig mesenchymal stromal cells, it is possible that upregulation of CD69 on human T cells initiates signaling events that would regulate CD4+ and CD8+ T cell activation and differentiation. PMID: 24044963
In patients with allergic rhinitis CD69 antigen is overexpressed on human peripheral blood natural killer cells reflecting their activation status. PMID: 23454781
This is the first report of the regulation of CD69 expression by LMP-1, and this novel finding may, thus, represent an important link between the EBV oncoprotein LMP-1 and its critical role in the development of EBV-associated diseases. PMID: 23546309
CD69 is induced by integrin alpha4beta1 outside-in signalling and T-cell receptor signalling. PMID: 23758320
CD69 overexpression is associated with the human T-cell leukemia virus type 1 infection and adult T-cell leukemia. PMID: 23507197
Intron I acts as an important regulatory element of CD69 expression. PMID: 22456278
CD69 is significantly correlated with poor clinical and biological prognostic factors and is confirmed to be an independent disease prognosticator in chronic lymphocytic leukemia. PMID: 21993667
Priming with apoptotic debris prevented DCs from establishing cytotoxicity toward live human tumor cells by inducing a Treg-cell population, defined by coexpression of CD39 and CD69 PMID: 22678911
T cells isolated from the hepatocellular carcinoma tissues expressed significantly more CD69 molecules than did those on paired circulating and nontumor-infiltrating T cells; these tumor-derived CD69(+) T cells could induce considerable IDO in monocytes PMID: 22184722
Results suggest that H. pylori induces CD69 expression through the activation of NF-kappaB, and that cagPAI might be relevant in the induction of CD69 expression in T cells. CD69 in T cells may play a role in H. pylori-induced gastritis. PMID: 21990950
Caffeine does not appear to depress Natural killer cell CD69 expression. PMID: 21152932
Studies provide a mechanistic link between CD69 and the regulation of T(H)17 responses. PMID: 21427408
The expression of CD69 in T lymphocytes from nasal polyps was abnormally high. PMID: 15952571
structure refined to 1.37 A resolution provides further details of the overall structure and the asymmetric interface between the monomers in the native dimer PMID: 20054122
analysis of CD69 molecules on human CD4+ T cell membrane PMID: 19670272
CD69 engagement initiates protein tyrosine kinase-dependent signaling pathways in IL-2-activated NK cells by inducing selective activation of Syk, but not ZAP70, kinase. PMID: 12077230
CD69 transduces a Bcl-2-dependent death signal when ligated by a specific antibody. As the function of CD69 appears to be restricted to activated eosinophils, making an ideal target for therapeutic intervention in asthma. PMID: 12234263
a higher CD69 expression when atopic neutrophils were incubated with GM-CSF compared to non-atopic neutrophils PMID: 12540017
GM-CSF, IFN-gamma or IFN-alpha significantly induced CD69 expression on neutrophils. We demonstrated the capacity of CD69 to act as a costimulus for TNF-alpha production by neutrophils. PMID: 12718936
expression of CD69 on CD3+ and CD8+ peripheral blood T cells correlates closely with the presence of acute graft rejection in renal allograft recipients PMID: 12865808
Increased CD69 of T lymphocytes, along with abnormally elevated immunologically active molecules play an important role in immune pathogenesis of patients with myelodysplastic syndrome(MDS). PMID: 14728878
CD69 forms a complex with and negatively regulates S1P1 and that it functions downstream of IFN-alpha/beta, and possibly other activating stimuli, to promote lymphocyte retention in lymphoid organs PMID: 16525420
Plasmodium falciparum histidine-rich protein II reduces CD69 expression in T cells. PMID: 16788832
data suggest unidentified natural ligands for CD69 and/or CD69 autoantibodies possibly affect joint-composing cell types through increased production of S100A9 in neutrophils, providing insight into functions of CD69 on neutrophils in rheumatoid arthritis PMID: 17237603
IL-3 is a central inducer of CD69 expression. Upregulated CD69 expression on locally accumulated basophils in bronchial asthma may be partly due to a combination of local cytokines, especially IL-3, plus IgE-cross-linking allergens. PMID: 17541278
Since induction of CD69 surface expression is dependent on the activation of the protein kinase C (PKC) activation pathway, it is suggested that in chronic fatigue syndrome there is a disorder in the early activation of the immune system involving PKC. PMID: 17693977
results do not support a major role for the CD69 gene polymorphisms in RA genetic predisposition in our population. PMID: 18627570
the physical, biochemical and in vivo characteristics of a highly stable soluble form of CD69 obtained by bacterial expression of an appropriate extracellular segment of this protein. PMID: 18959746
Expression of CD69 and IL8 is upregulated upon Bcr-Abl expression PMID: 19383348
soluble factors in SSc plasma inhibit Treg function specifically that is associated with altered Treg CD69 and TGFbeta expression PMID: 19543397

Hide All

Subcellular Location

Membrane; Single-pass type II membrane protein.

Tissue Specificity

Expressed on the surface of activated T-cells, B-cells, natural killer cells, neutrophils, eosinophils, epidermal Langerhans cells and platelets.

Database Links

HGNC: 1694

OMIM: 107273

KEGG: hsa:969

STRING: 9606.ENSP00000228434

UniGene: Hs.208854

Place an order now

I. Product details

Product name *

Code *

Size *

Quantity *

Message

II. Contact details

Name *

Email address *

Company/Organization

Phone

III. Ship To

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

IV. Bill To Same as Shipping Address

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

CAPTCHA verification *

Code	CSB-MP004952HU
MSDS	MSDS
Size	$318
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized Human CD69 at 2μg/mL can bind Anti-CD69 recombinant antibody (CSB-RA004952MA1HU)， the EC₅₀ is 23.17-26.04 ng/mL. Biological Activity Assay
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Early activation antigen CD69 (CD69), partial (Active)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage