Recombinant Human Early activation antigen CD69(CD69),partial (Active)

In Stock
Code CSB-MP004952HU
Size $318
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Human CD69 at 2μg/mL can bind Anti-CD69 recombinant antibody (CSB-RA004952MA1HU), the EC50 is 23.17-26.04 ng/mL. Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 96.7% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①Measured by its binding ability in a functional ELISA. Immobilized Human CD69 at 2 μg/mL can bind Anti-CD69 recombinant antibody (CSB-RA004952MA1HU), the EC50 is 23.17-26.04 ng/mL.
Target Names
CD69
Uniprot No.
Alternative Names
(Activation inducer molecule)(BL-AC/P26)(C-type lectin domain family 2 member C)(EA1)(Early T-cell activation antigen p60)
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
62-199aa
Target Protein Sequence
SVGQYNCPGQYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKRYAGREEHWVGLKKEPGHPWKWSNGKEFNNWFNVTGSDKCVFLKNTEVSSMECEKNLYWICNKPYK
Mol. Weight
18.7 kDa
Protein Length
Extracellular Domain
Tag Info
C-terminal 10xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Involved in lymphocyte proliferation and functions as a signal transmitting receptor in lymphocytes, natural killer (NK) cells, and platelets.
Gene References into Functions
  1. CD69 is a direct target of miR-367-3p. PMID: 30015935
  2. The frequency of CD69+ T cells was significantly higher in CD8+ and CD4+ T cells in nasal polyps compared with the peripheral blood of patients with chronic rhinosinusitis. PMID: 29749428
  3. this paper shows that decrease of CD69 levels on TCR Valpha7.2(+)CD4(+) innate-like lymphocytes is associated with impaired cytotoxic functions in chronic hepatitis B virus-infected patients PMID: 28606013
  4. AIM expression in the kidney was associated with urinary protein and decline in kidney function. PMID: 26846784
  5. Higher CD69 expression were less sensitive to bendamustine and is associated with chronic lymphocytic leukemia. PMID: 26701728
  6. In vitro functional assays showed that CD69(+) Treg cells exerted an important suppressive effect on the activation of T effector cells PMID: 26100786
  7. results demonstrate the functional and mechanistic interplays between CD69 and S100A8/S100A9 in supporting Treg-cell differentiation PMID: 26296369
  8. Elevated expression of CD69 and CD161 on NK cells can be considered as immunological risk markers in RSA and IVF failure. PMID: 24975965
  9. these findings identify CD69 and galectin-1 to be a novel regulatory receptor-ligand pair that modulates Th17 effector cell differentiation and function. PMID: 24752896
  10. REVIEW: CD69 exerts a complex immunoregulatory role in humans, and that it could be considered as a target molecule for the therapy of immune-mediated diseases PMID: 23954168
  11. Following coculture with GTKO/CD46 pig mesenchymal stromal cells, it is possible that upregulation of CD69 on human T cells initiates signaling events that would regulate CD4+ and CD8+ T cell activation and differentiation. PMID: 24044963
  12. In patients with allergic rhinitis CD69 antigen is overexpressed on human peripheral blood natural killer cells reflecting their activation status. PMID: 23454781
  13. This is the first report of the regulation of CD69 expression by LMP-1, and this novel finding may, thus, represent an important link between the EBV oncoprotein LMP-1 and its critical role in the development of EBV-associated diseases. PMID: 23546309
  14. CD69 is induced by integrin alpha4beta1 outside-in signalling and T-cell receptor signalling. PMID: 23758320
  15. CD69 overexpression is associated with the human T-cell leukemia virus type 1 infection and adult T-cell leukemia. PMID: 23507197
  16. Intron I acts as an important regulatory element of CD69 expression. PMID: 22456278
  17. CD69 is significantly correlated with poor clinical and biological prognostic factors and is confirmed to be an independent disease prognosticator in chronic lymphocytic leukemia. PMID: 21993667
  18. Priming with apoptotic debris prevented DCs from establishing cytotoxicity toward live human tumor cells by inducing a Treg-cell population, defined by coexpression of CD39 and CD69 PMID: 22678911
  19. T cells isolated from the hepatocellular carcinoma tissues expressed significantly more CD69 molecules than did those on paired circulating and nontumor-infiltrating T cells; these tumor-derived CD69(+) T cells could induce considerable IDO in monocytes PMID: 22184722
  20. Results suggest that H. pylori induces CD69 expression through the activation of NF-kappaB, and that cagPAI might be relevant in the induction of CD69 expression in T cells. CD69 in T cells may play a role in H. pylori-induced gastritis. PMID: 21990950
  21. Caffeine does not appear to depress Natural killer cell CD69 expression. PMID: 21152932
  22. Studies provide a mechanistic link between CD69 and the regulation of T(H)17 responses. PMID: 21427408
  23. The expression of CD69 in T lymphocytes from nasal polyps was abnormally high. PMID: 15952571
  24. structure refined to 1.37 A resolution provides further details of the overall structure and the asymmetric interface between the monomers in the native dimer PMID: 20054122
  25. analysis of CD69 molecules on human CD4+ T cell membrane PMID: 19670272
  26. CD69 engagement initiates protein tyrosine kinase-dependent signaling pathways in IL-2-activated NK cells by inducing selective activation of Syk, but not ZAP70, kinase. PMID: 12077230
  27. CD69 transduces a Bcl-2-dependent death signal when ligated by a specific antibody. As the function of CD69 appears to be restricted to activated eosinophils, making an ideal target for therapeutic intervention in asthma. PMID: 12234263
  28. a higher CD69 expression when atopic neutrophils were incubated with GM-CSF compared to non-atopic neutrophils PMID: 12540017
  29. GM-CSF, IFN-gamma or IFN-alpha significantly induced CD69 expression on neutrophils. We demonstrated the capacity of CD69 to act as a costimulus for TNF-alpha production by neutrophils. PMID: 12718936
  30. expression of CD69 on CD3+ and CD8+ peripheral blood T cells correlates closely with the presence of acute graft rejection in renal allograft recipients PMID: 12865808
  31. Increased CD69 of T lymphocytes, along with abnormally elevated immunologically active molecules play an important role in immune pathogenesis of patients with myelodysplastic syndrome(MDS). PMID: 14728878
  32. CD69 forms a complex with and negatively regulates S1P1 and that it functions downstream of IFN-alpha/beta, and possibly other activating stimuli, to promote lymphocyte retention in lymphoid organs PMID: 16525420
  33. Plasmodium falciparum histidine-rich protein II reduces CD69 expression in T cells. PMID: 16788832
  34. data suggest unidentified natural ligands for CD69 and/or CD69 autoantibodies possibly affect joint-composing cell types through increased production of S100A9 in neutrophils, providing insight into functions of CD69 on neutrophils in rheumatoid arthritis PMID: 17237603
  35. IL-3 is a central inducer of CD69 expression. Upregulated CD69 expression on locally accumulated basophils in bronchial asthma may be partly due to a combination of local cytokines, especially IL-3, plus IgE-cross-linking allergens. PMID: 17541278
  36. Since induction of CD69 surface expression is dependent on the activation of the protein kinase C (PKC) activation pathway, it is suggested that in chronic fatigue syndrome there is a disorder in the early activation of the immune system involving PKC. PMID: 17693977
  37. results do not support a major role for the CD69 gene polymorphisms in RA genetic predisposition in our population. PMID: 18627570
  38. the physical, biochemical and in vivo characteristics of a highly stable soluble form of CD69 obtained by bacterial expression of an appropriate extracellular segment of this protein. PMID: 18959746
  39. Expression of CD69 and IL8 is upregulated upon Bcr-Abl expression PMID: 19383348
  40. soluble factors in SSc plasma inhibit Treg function specifically that is associated with altered Treg CD69 and TGFbeta expression PMID: 19543397

Show More

Hide All

Subcellular Location
Membrane; Single-pass type II membrane protein.
Tissue Specificity
Expressed on the surface of activated T-cells, B-cells, natural killer cells, neutrophils, eosinophils, epidermal Langerhans cells and platelets.
Database Links

HGNC: 1694

OMIM: 107273

KEGG: hsa:969

STRING: 9606.ENSP00000228434

UniGene: Hs.208854

Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
Address
7505 Fannin St Ste 610-322 Houston, TX 77054, USA
Join Us with

Leave a message

check code
© 2007-2023 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1