Recombinant Human Glucagon-like peptide 1 receptor(GLP1R),partial

Code CSB-MP009514HU
Product Type Recombinant Protein
Size Pls inquiry other sizes
Uniprot No. P43220
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Relevance This is a receptor for glucagon-like peptide 1. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias GLP-1 receptor Short name: GLP-1-R Short name: GLP-1R
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence RPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEEQLLFLY
Research Area Neuroscience
Source Mammalian cell
Gene Names GLP1R
Expression Region 24-145aa
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Product Info N-terminal 6xHis-tagged
Mol. Weight 18.3kDa
Protein Description Partial
Still Have Questions? Leave a Message or Start an on-line Chat
Function G-protein coupled receptor for glucagon-like peptide 1 (GLP-1)
Subcellular location Cell membrane, Multi-pass membrane protein
Pathway cAMP signaling pathway

Related Products

GLP1R Antibodies

GLP1R Antibodies for Homo sapiens (Human)

GLP1R Antibodies for Mus musculus (Mouse)

GLP1R Proteins

GLP1R Proteins for Rattus norvegicus (Rat)

GLP1R Proteins for Homo sapiens (Human)

GLP1R Proteins for Mus musculus (Mouse)

GLP1R cDNA

GLP1R cDNA for Rattus norvegicus (Rat)

GLP1R ELISA Kit

GLP1R ELISA Kit for Homo sapiens (Human)

GLP1R ELISA Kit for Mus musculus (Mouse)

GLP1R ELISA Kit for Rattus norvegicus (Rat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.

Wait!

Join the 25,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now!

We don't deal in spam.