Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Neuroscience
Alternative Names
GLP1R; Glucagon-like peptide 1 receptor; GLP-1 receptor; GLP-1-R; GLP-1R
Species
Homo sapiens (Human)
Expression Region
24-145aa
Target Protein Sequence
RPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEEQLLFLY
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The fusion tag N-terminal 6xHis tag gene was added to the gene sequence corresponding to the mammalian cell of the human GLP1R protein to form the recombinant DNA. The recombinant DNA was cloned into the expression vector and then transfected into the mammalian cell for expression. Following purification, the product is the recombinant human GLP1R protein carrying N-terminal 6xHis tag. The SDS-PAGE assessed the purity of this recombinant GLP1R protein up to 90%. It had an apparent molecular weight of approximately 18 kDa. This recombinant GLP1R protein may find use in neuroscience research.
GLP1R is a gene presented on chromosome 6 providing instructions for making a protein called glucagon-like peptide 1 receptor in human and belongs to G-protein coupled receptor 2 family. GLP1R is a receptor protein expressed in beta cells of the pancreas and neurons of the brain. It is involved in the control of blood sugar level by enhancing insulin secretion. Studies have reported that GLP1R is a significant therapeutic target for small molecule drug discovery given the therapeutic impact of peptide agonists in the diabetes sphere.