Recombinant Human Glucocorticoid receptor(NR3C1),partial

In Stock
Code CSB-EP016059HU1c2
Product Type Recombinant Protein
Size US$2466
Uniprot No. P04150
Relevance Receptor for glucocorticoids (GC). Has a dual mode of action: as a transcription factor that binds to glucocorticoid response elements (GRE), both for nuclear and mitochondrial DNA, and as a modulator of other transcription factors. Affects inflammatory responses, cellular proliferation and differentiation in target tissues. Involved in chromatin remodeling. Plays a role in rapid mRNA degradation by binding to the 5' UTR of target mRNAs and interacting with PNRC2 in a ligand-dependent manner which recruits the RNA helicase UPF1 and the mRNA-decapping enzyme DCP1A, leading to RNA decay. Could act as a coactivator for STAT5-dependent transcription upon growth hormone (GH) stimulation and could reveal an essential role of hepatic GR in the control of body growth
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence VPATLPQLTPTLVSLLEVIEPEVLYAGYDSSVPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMFLMAFALGWRSYRQSSANLLCFAPDLIINEQRMTLPCMYDQCKHMLYVSSELHRLQVSYEEYLCMKTLLLLSSVPKDGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTKLLDSMHEVVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQK
Research Area Epigenetics and Nuclear Signaling
Source E.coli
Gene Names NR3C1
Protein Names Nuclear receptor subfamily 3 group C member 1 GRL
Expression Region 521-777aa
Tag Info N-terminal 6xHis-Trx-tagged
Mol. Weight 47.8 kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for glucocorticoids (GC)
Involvement in disease Glucocorticoid resistance, generalized (GCCR)
Subcellular Location Isoform Alpha: Cytoplasm, Nucleus, Mitochondrion, Cytoplasm, cytoskeleton, spindle, Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, Note=After ligand activation, translocates from the cytoplasm to the nucleus, SUBCELLULAR LOCATION: Isoform Beta: Nucleus, Cytoplasm, Note=Expressed predominantly in the nucleus with some expression also detected in the cytoplasm, SUBCELLULAR LOCATION: Isoform Alpha-B: Nucleus, Cytoplasm
Protein Families Nuclear hormone receptor family, NR3 subfamily
Tissue Specificity Widely expressed including bone, stomach, lung, liver, colon, breast, ovary, pancreas and kidney (PubMed:25847991). In the heart, detected in left and right atria, left and right ventricles, aorta, apex, intraventricular septum, and atrioventricular node
Database Links

HGNC: 7978

OMIM: 138040

KEGG: hsa:2908

STRING: 9606.ENSP00000231509

UniGene: Hs.122926

Related Products

NR3C1 Antibodies

NR3C1 Antibodies for Homo sapiens (Human)

NR3C1 Antibodies for Human

NR3C1 Proteins

NR3C1 Proteins for Homo sapiens (Human)

NR3C1 ELISA Kit

NR3C1 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.