Recombinant Human Interleukin-8(CXCL8),partial

Code CSB-EP011671HU1
Product Type Recombinant Protein
Size US$1726
Uniprot No. P10145
Relevance IL-8 is a chotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus. IL-8(6-77) has a 5-10-fold higher activity on neutrophil activation, IL-8(5-77) has increased activity on neutrophil activation and IL-8(7-77) has a higher affinity to receptors CXCR1 and CXCR2 as compared to IL-8(1-77), respectively.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Tris-based buffer,50% glycerol
Alias C-X-C motif chemokine hemokine (C-X-C motif) ligand 8Emoctakin;Granulocyte chemotactic protein 1 ;GCP-1Monocyte-derived neutrophil chemotactic factor ;MDNCFMonocyte-derived neutrophil-activating peptide ;MONAPNeutrophil-activating protein 1 ;NAP-1;Protein 3-10CT-cell chemotactic factor
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
Research Area Immunology
Source E.coli
Gene Names CXCL8
Expression Region 28-99aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 12.4kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus. IL-8(6-77) has a 5-10-fold higher activity on neutrophil activation, IL-8(5-77) has increased activity on neutrophil activation and IL-8(7-77) has a higher affinity to receptors CXCR1 and CXCR2 as compared to IL-8(1-77), respectively.
Subcellular Location Secreted
Protein Families Intercrine alpha (chemokine CxC) family
Database Links

HGNC: 6025

OMIM: 146930

KEGG: hsa:3576

STRING: 9606.ENSP00000306512

UniGene: Hs.624

Pathway Chemokine signaling pathway
NF-kappa B signaling pathway
Cellular senescence
IL-17 signaling pathway
NOD-like receptor signaling pathway
Toll-like receptor signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Oxidative Phosphorylation
Phospholipase D signaling pathway

Related Products

CXCL8 Antibodies

CXCL8 Antibodies for Homo sapiens (Human)

CXCL8 Antibodies for Human

CXCL8 Proteins

CXCL8 Proteins for Homo sapiens (Human)

CXCL8 ELISA Kit

CXCL8 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.