Product Details

Purity

≥ 95% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

Measured by its binding ability in a functional ELISA. Immobilized Human CXCL8 at 2 μg/mL can bind Anti-CXCL8 recombinant antibody (CSB-RA011671MA1HU). The EC50 is 43.95-46.76 ng/mL.

Target Names

CXCL8

Uniprot No.

P10145

Alternative Names

Interleukin-8; IL-8; C-X-C motif chemokine 8; Chemokine (C-X-C motif) ligand 8; Emoctakin; Granulocyte chemotactic protein 1 (GCP-1); Monocyte-derived neutrophil chemotactic factor (MDNCF); CXCL8; IL8

Species

Homo sapiens (Human)

Source

Yeast

Expression Region

28-99aa

Target Protein Sequence

SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS

Mol. Weight

10.4 kDa

Protein Length

Partial

Tag Info

C-terminal 10xHis-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

CXCL8 orchestrates neutrophil recruitment and activation at sites of inflammation, making precise control of its signaling potency essential for dissecting immune cell behavior in vitro. This recombinant protein, spanning residues 28–99 of the mature human sequence, demonstrates specific antibody binding in functional ELISA with an EC50 of 43.95–46.76 ng/mL, providing quantitative evidence of correct folding and epitope accessibility that supports its use as a coating antigen in antibody validation assays, an immunogen for monoclonal antibody development, and a positive control in cytokine detection platforms. The endotoxin level below 1.0 EU/μg meets the threshold required for neutrophil chemotaxis assays and primary immune cell activation studies, where LPS contamination would confound interpretation of CXCL8-specific signaling through CXCR1 and CXCR2. Purity exceeding 95% by SDS-PAGE, combined with the validated binding activity, aligns with standards expected in signaling pathway studies examining NF-κB and MAPK activation downstream of chemokine receptor engagement.

Code	CSB-YP011671HU1
Abbreviation	Recombinant Human CXCL8 protein, partial (Active)
MSDS	MSDS Datasheet
Size	$250
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized Human CXCL8 at 2 μg/ml can bind Anti-CXCL8 recombinant antibody (CSB-RA011671MA1HU). The EC₅₀ is 43.95-46.76 ng/mL. Biological Activity Assay
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Interleukin-8 (CXCL8), partial (Active)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage