Recombinant Human Mucin-16 (MUC16), partial

In Stock
Code CSB-EP704410HU3
Abbreviation Recombinant Human MUC16 protein, partial
MSDS
Size $388
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cancer
Alternative Names
Ovarian cancer-related tumor marker CA125 (CA-125) (Ovarian carcinoma antigen CA125)
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
12660-12923aa
Target Protein Sequence
GFTHWIPVPTSSTPGTSTVDLGSGTPSSLPSPTTAGPLLVPFTLNFTITNLKYEEDMHCPGSRKFNTTERVLQSLLGPMFKNTSVGPLYSGCRLTLLRSEKDGAATGVDAICTHRLDPKSPGVDREQLYWELSQLTNGIKELGPYTLDRNSLYVNGFTHQTSAPNTSTPGTSTVDLGTSGTPSSLPSPTSAGPLLVPFTLNFTITNLQYEEDMHHPGSRKFNTTERVLQGLLGPMFKNTSVGLLYSGCRLTLLRPEKNGAATGM
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
29.3 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces.
Gene References into Functions
  1. Studied levels of mucin 16 (CA125), adenosine deaminase and midkine as tumor markers in nonsmall cell lung cancer-associated malignant pleural effusion. PMID: 29797475
  2. The expression profile of studied Mucins MUC16 and MUC1 and truncated O-glycans was not associated with the site of origin of ovarian cancer (OVCA) cell lines PMID: 30011875
  3. Serum HE4 with its high specificity is useful in ruling out ovarian malignancy especially among the premenopausal women and Risk of Ovarian Malignancy Algorithm (ROMA)which is the combination of both serum CA 125 and HE4, appears to be an all-rounder with overall good sensitivity and specificity especially among the postmenopausal women. PMID: 30063463
  4. CA125 appears the most reliable biomarker for OC monitoring, whereas HE4 contributes additional information only in a minority of cases PMID: 30125544
  5. The level of HE4 in ovarian cancer ascites may reflect the therapeutic effect of ovarian cancer patients, and a high level of HE4 might predict chemoresistance and the possibility of ascites formation. The determination of the expression of HE4 alone or combined with CA125 levels in both serum and ascites in ovarian cancer patients with ascites may have important significance for guiding and improving the treatment PMID: 29903044
  6. Lower CA125 serum levels, negative vascular invasion, and wild-type BRAF status were significantly associated with improved 2-year DFS rates among patient with stage III disease who received adjuvant chemotherapy. PMID: 29562502
  7. We can infer from this study that increased maternal serum CA 125 levels are associated with the preeclampsia and its severity. PMID: 29718786
  8. Serum CA125 concentrations are correlated with coronary artery calcification score in the population without known coronary artery disease. PMID: 29731508
  9. High serum CA125 level is associated with epithelial ovarian cancer. PMID: 28444641
  10. Serum CA-125 was significantly different between infertile women with and without pelvic endometriosis. PMID: 29944231
  11. Use of HE4 instead of CA125 did not significantly improve diagnostic performance of risk of malignancy indices 1-4 in patients with an adnexal mass PMID: 29238719
  12. TP53 autoantibody levels provide a biomarker with clinically significant lead time over elevation of CA125 or an elevated ROCA value. Quantitative assessment of autoantibodies in combination with CA125 holds promise for earlier detection of invasive epithelial ovarian cancer PMID: 28637689
  13. CA-125 levels may be the most useful marker for predicting advanced-stage disease PMID: 25761476
  14. For screened women at familial/genetic ovarian cancer risk, risk of ovarian cancer algorithm had better early-stage sensitivity at high specificity, and low yet possibly acceptable positive predictive value compared with CA125 , warranting further larger cohort evaluation. PMID: 28143870
  15. Serum SCC-Ag, hs-CRP, and CA-125 were higher in recurrence cervical patients which could be potential biomarkers for predicting cervical cancer recurrence risk. PMID: 28901315
  16. The determination of CA125 before surgery may be helpful in the evaluation of the regional lymph nodes, and is a poor prognostic factor for overall survival and disease-free survival in endometrial cancer. PMID: 28624692
  17. High CA125 expression is associated with adnexal malignancy. PMID: 27116243
  18. The ratio between menstrual and midcycle phases had the worst performance. CA-125 may be useful for the diagnosis of deep endometriosis, especially when both are collected during menstruation and in midcycle. PMID: 28660213
  19. Architect CA 125 II and HE4 values in Chinese women presenting with a pelvic mass PMID: 28549533
  20. highly predictive of endometriosis in women with symptoms of pain and/or subfertility PMID: 27987404
  21. HE4 seems to be superior to CA125 in the detection of recurrent disease. PMID: 29463191
  22. High CA125 expression is associated with breast, endometrial and ovarian cancers. PMID: 26918940
  23. knockdown of MUC16 significantly weakened the capabilities of cells for proliferation and migration PMID: 27167110
  24. In this platinum-resistant population, PD was typically detected earlier by imaging than by CA-125, irrespective of bevacizumab treatment. Disease status by CA-125 at the time of PD was not prognostic for overall survival. Regular radiologic assessment as well as symptom benefit assessment should be considered during PROC follow-up. PMID: 27407100
  25. Data characterized CA-125 kinetics and identified modeled kinetic parameters. PMID: 29187468
  26. these studies demonstrate that PPARgamma is an important modulator of MUC16 expression. PMID: 27292441
  27. These data point to a novel opportunity to enrich Abs at mucosal sites by targeting Abs to MUC16 through changes in Fc glycosylation, potentially blocking viral movement and sequestering the virus far from the epithelial border. PMID: 26960182
  28. Within this review, we highlight both the processes involved in the expression of aberrant glycan structures on mucins, as well as the potential downstream impacts on cellular signaling. PMID: 27483328
  29. In a cohort of patients with acute decompensated heart failure, cancer antigen 125 is independently associated with prolonged length of stay. PMID: 28265209
  30. The current study uncovers the contribution of oncogenic KRAS to serum marker CA125 production through a mechanism that involves the ERK/c-Myc axis. PMID: 28108627
  31. Mesothelin/mucin 16 signaling in activated portal fibroblasts regulates cholestatic liver fibrosis. PMID: 28287406
  32. the loss of MUC16 and E-cadherin expression resulted in the formation of more compact spheroids. In addition, our data describe an unusual link between E-cadherin expression and less compact spheroids. Our data also emphasize the role of MUC16 and b1 integrin in Epithelial ovarian cancer (EOC) spheroid formation. PMID: 27612856
  33. Preoperative CA-125 can predict neither the progression-free nor overall survival for primary serous ovarian cancer patients. PMID: 28551658
  34. In pseudomyxoma peritonei CA125 was infrequently expressed by tumor cells, but in most of the cases adjacent nonneoplastic mesothelial cells. PMID: 27038681
  35. Differences in the apparent expression levels of CEA, CA153 and CA125 in patients with nipple discharge and healthy persons were validated. PMID: 27327081
  36. The endometrial expression of PR and Ki67 along with serum CA125 predicted the development of lymph node metastasis in endometrial cancer. PMID: 27163153
  37. a distinct role for N-glycans in promoting MUC16's binding affinity toward galectin-3 and in causing retention of the lectin on the epithelial cell surface. PMID: 28487369
  38. HE4 is elevated less frequently than CA125 in benign adnexal tumors, regardless of age or menopausal status PMID: 27752776
  39. rebamipide induces the differential upregulation of MUC16 in stratified cultures of human corneal epithelial cells, which may have implications to the proper restoration of barrier function in ocular surface disease. PMID: 27725198
  40. In postmenopausal women, CA-125 levels were significantly higher in those with epithelial ovarian cancer. PMID: 27855043
  41. When the value of CA125 is higher than 10 U/ml and continuously increased, need to be vigilant and should be combined with imaging examination (PET-CT), early detection of recurrent lesions and early retreatment, especially maybe have the opportunity for surgery, this result may improve the prognosis for recurrent patients. PMID: 28284216
  42. Pap test abnormalities are frequent in ECCC. Although it is less accurate in the diagnosis of ECCC than in the detection of malignancy, endometrial sampling is still the main procedure for the diagnosis of ECCC. Higher preoperative CA-125 concentrations imply the presence of advanced stage ECCC. PMID: 27173475
  43. levels before treatment and decreased speed of decline of serum CA125 after treatment were independent factors. There is a negative correlation between pre-treatment CA125 level and prognosis, the sooner decrease of CA125 levels post-treatment the better prognosis are. PMID: 27629537
  44. We found the high specificity of HE4 and CA125 while differentiating ovarian benign diseases from epithelial ovarian cancer in postmenopausal women and the high sensitivity of CA125 in detecting epithelial ovarian cancer in premenopausal patients PMID: 27436085
  45. Results collectively indicate unique links between dual-specificity phosphatase 28 (DUSP28) and mucins MUC5B/MUC16 and their roles in pancreatic cancer. PMID: 27230679
  46. that, in adenocarcinomas and borderline ovarian tumors, the major carriers of SLe(a) and SLe(x) are MUC16 and/or MUC1 (100 and 92 % for SLe(a) PMID: 27003157
  47. A statistically significant difference was observed between HE4 values at primary diagnosis and at recurrence, respectively, comparing recurrent and non-recurrent patients while CA125 values resulted not statistically significant at each time point. PMID: 26531723
  48. We assessed the diagnostic accuracy of a newly developed laboratory score-based on CA125, platelet count (PLT), C-reactive protein (CRP), and fibrinogen levels-in the preoperative diagnosis of adnexal mass PMID: 26499778
  49. High CA125 expression is associated with Ovarian Tumors. PMID: 27268637
  50. We evaluated the clinical performance of LOCItrade mark-based tumor marker assays CEA, CA19-9, CA15-3, CA125 and AFP in patients with gastrointestinal cancer and demonstrated their high diagnostic power PMID: 28011514

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type I membrane protein. Secreted, extracellular space. Note=May be liberated into the extracellular space following the phosphorylation of the intracellular C-terminus which induces the proteolytic cleavage and liberation of the extracellular domain.
Tissue Specificity
Expressed in corneal and conjunctival epithelia (at protein level). Overexpressed in ovarian carcinomas and ovarian low malignant potential (LMP) tumors as compared to the expression in normal ovarian tissue and ovarian adenomas.
Database Links

HGNC: 15582

OMIM: 606154

KEGG: hsa:94025

STRING: 9606.ENSP00000381008

UniGene: Hs.432676

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*