Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized MUC16 at 10 μg/ml can bind MSLN(CSB-MP015044HUc9), the EC50 is 460.7-662.2 ng/ml.
Alternative Names
(MUC-16)(Ovarian cancer-related tumor marker CA125)(CA-125)(CA125)
Molecular Characterization
Species
Homo sapiens (Human)
Expression Region
12660-12923aa
Target Protein Sequence
GFTHWIPVPTSSTPGTSTVDLGSGTPSSLPSPTTAGPLLVPFTLNFTITNLKYEEDMHCPGSRKFNTTERVLQSLLGPMFKNTSVGPLYSGCRLTLLRSEKDGAATGVDAICTHRLDPKSPGVDREQLYWELSQLTNGIKELGPYTLDRNSLYVNGFTHQTSAPNTSTPGTSTVDLGTSGTPSSLPSPTSAGPLLVPFTLNFTITNLQYEEDMHHPGSRKFNTTERVLQGLLGPMFKNTSVGLLYSGCRLTLLRPEKNGAATGM
Tag Info
C-terminal 6xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The recombinant human Mucin-16 (MUC16) is generated by expressing the DNA fragment that corresponds to amino acids Gly12660-Met12923 of the human MUC16 protein in the mammalian cells. It is tagged with a 6xHis tag at the C-terminus. It is an active protein with high purity (> 95%, SDS-PAGE) and low endotoxin (< 1.0 EU/ug protein, LAL method). Due to glycosylation, this MUC16 protein ran to the molecular weight band of approximately 45 kDa. Its bioactivity was validated through the functional ELISA, in which this MUC16 protein can bind to MSLN with the EC50 of 460.7-662.2 ng/ml. And it is in stock now.
MUC16, also termed CA125, promotes cancer cell proliferation and inhibits anti-cancer immune responses. It is a crucial marker for ovarian cancer.